Gene/Proteome Database (LMPD)
LMPD ID
LMP012607
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
phosphatidylethanolamine binding protein 1
Gene Symbol
Synonyms
Pbp; HCNP; Rkip;
Alternate Names
phosphatidylethanolamine-binding protein 1; P23K; HCNPpp; PEBP-1; Raf-1 kinase inhibitor protein; 23 kDa morphine-binding protein; hippocampal cholinergic neurostimulating peptide;
Chromosome
12
Map Location
12q16
Summary
lipid binding protein; enhances acetylcholine synthesis in medial septal regions; human homolog (RKIP) has been shown to inhibit MEK- and ERK- signalling pathways [RGD, Feb 2006]
Orthologs
Proteins
phosphatidylethanolamine-binding protein 1 | |
---|---|
Refseq ID | NP_058932 |
Protein GI | 8393910 |
UniProt ID | P31044 |
mRNA ID | NM_017236 |
Length | 187 |
MAADISQWAGPLSLQEVDEPPQHALRVDYGGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRKDPKFREWHHFLVVNMKGNDISSGTVLSEYVGSGPPKDTGLHRYVWLVYEQEQPLNCDEPILSNKSGDNRGKFKVESFRKKYHLGAPVAGTCFQAEWDDSVPKLHDQLAGK |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylethanolamine binding protein 1
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0045177 | IDA:RGD | C | apical part of cell |
GO:0043679 | IDA:RGD | C | axon terminus |
GO:0009986 | IDA:RGD | C | cell surface |
GO:0005737 | IDA:RGD | C | cytoplasm |
GO:0005615 | IDA:RGD | C | extracellular space |
GO:0005794 | IDA:RGD | C | Golgi apparatus |
GO:0005741 | IDA:RGD | C | mitochondrial outer membrane |
GO:0005739 | IDA:RGD | C | mitochondrion |
GO:0043025 | IDA:RGD | C | neuronal cell body |
GO:0043005 | IDA:RGD | C | neuron projection |
GO:0005791 | IDA:RGD | C | rough endoplasmic reticulum |
GO:0008021 | IDA:RGD | C | synaptic vesicle |
GO:0005524 | IDA:RGD | F | ATP binding |
GO:0019900 | IPI:RGD | F | kinase binding |
GO:0008289 | TAS:RGD | F | lipid binding |
GO:0051019 | IDA:RGD | F | mitogen-activated protein kinase binding |
GO:0019901 | IPI:RGD | F | protein kinase binding |
GO:0005102 | IDA:RGD | F | receptor binding |
GO:0004867 | IEA:UniProtKB-KW | F | serine-type endopeptidase inhibitor activity |
GO:0007568 | IEP:RGD | P | aging |
GO:0007420 | IEP:RGD | P | brain development |
GO:0042755 | IEP:RGD | P | eating behavior |
GO:0000165 | IDA:RGD | P | MAPK cascade |
GO:0043409 | IMP:RGD | P | negative regulation of MAPK cascade |
GO:0001933 | IMP:RGD | P | negative regulation of protein phosphorylation |
GO:0060409 | IDA:RGD | P | positive regulation of acetylcholine metabolic process |
GO:0043950 | IMP:RGD | P | positive regulation of cAMP-mediated signaling |
GO:0045840 | IMP:RGD | P | positive regulation of mitosis |
GO:0001505 | IDA:RGD | P | regulation of neurotransmitter levels |
GO:0002026 | IDA:RGD | P | regulation of the force of heart contraction |
GO:0014823 | IEP:RGD | P | response to activity |
GO:0051592 | IEP:RGD | P | response to calcium ion |
GO:0051591 | IEP:RGD | P | response to cAMP |
GO:0051412 | IEP:RGD | P | response to corticosterone |
GO:0042493 | IEP:RGD | P | response to drug |
GO:0051602 | IEP:RGD | P | response to electrical stimulus |
GO:0045471 | IEP:RGD | P | response to ethanol |
GO:0009408 | IEP:RGD | P | response to heat |
GO:0014070 | IEP:RGD | P | response to organic cyclic compound |
GO:0010033 | IEP:RGD | P | response to organic substance |
GO:0010243 | IEP:RGD | P | response to organonitrogen compound |
GO:0006979 | IEP:RGD | P | response to oxidative stress |
GO:0009636 | IEP:RGD | P | response to toxic substance |
GO:0009611 | IEP:RGD | P | response to wounding |
GO:0007286 | IEP:RGD | P | spermatid development |
GO:0048240 | IEA:Ensembl | P | sperm capacitation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylethanolamine binding protein 1
Protein Entry
PEBP1_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Function | Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase (By similarity). Inhibits the kinase activity of RAF1 by inhibiting its activation and by dissociating the RAF1/MEK complex and acting as a competitive inhibitor of MEK phosphorylation (By similarity) |
Function | HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor. |
Miscellaneous | Seems to be associated with memory and learning disorder. |
Similarity | Belongs to the phosphatidylethanolamine-binding protein family |
Subcellular Location | Cytoplasm. Membrane; Peripheral membrane protein. |
Subunit | Has a tendency to form dimers by disulfide cross-linking. Interacts with RAF1 and this interaction is enhanced if RAF1 is phosphorylated on residues 'Ser-338', 'Ser-339', 'Tyr-340' and 'Tyr-341'. Interacts with ALOX15; in response to IL13/interleukin- 13, prevents the interaction of PEBP1 with RAF1 to activate the ERK signaling cascade (By similarity) |
Tissue Specificity | Major component of epididymal secretions and sperm plasma membranes. It is present in cytosols from a variety of other tissues. Highly expressed in brain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012607 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
8393910 | RefSeq | NP_058932 | 187 | phosphatidylethanolamine-binding protein 1 |
Identical Sequences to LMP012607 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:8393910 | GenBank | AAQ40680.1 | 187 | Sequence 7 from patent US 6573430 |
GI:8393910 | GenBank | AAH63171.1 | 187 | Phosphatidylethanolamine binding protein 1 [Rattus norvegicus] |
GI:8393910 | GenBank | ABN26885.1 | 187 | Sequence 7 from patent US 7157279 |
GI:8393910 | GenBank | EDM13831.1 | 187 | phosphatidylethanolamine binding protein 1, isoform CRA_c [Rattus norvegicus] |
Related Sequences to LMP012607 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:8393910 | GenBank | AAQ40680.1 | 187 | Sequence 7 from patent US 6573430 |
GI:8393910 | GenBank | AAH63171.1 | 187 | Phosphatidylethanolamine binding protein 1 [Rattus norvegicus] |
GI:8393910 | GenBank | ABN26885.1 | 187 | Sequence 7 from patent US 7157279 |