Gene/Proteome Database (LMPD)

LMPD ID
LMP012607
Gene ID
29542
Species
Rattus norvegicus (Rat)
Gene Name
phosphatidylethanolamine binding protein 1
Gene Symbol
Pebp1
Synonyms
Pbp; HCNP; Rkip;
Alternate Names
phosphatidylethanolamine-binding protein 1; P23K; HCNPpp; PEBP-1; Raf-1 kinase inhibitor protein; 23 kDa morphine-binding protein; hippocampal cholinergic neurostimulating peptide;
Chromosome
12
Map Location
12q16
Summary
lipid binding protein; enhances acetylcholine synthesis in medial septal regions; human homolog (RKIP) has been shown to inhibit MEK- and ERK- signalling pathways [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Pebp1

Proteins

phosphatidylethanolamine-binding protein 1
Refseq ID NP_058932
Protein GI 8393910
UniProt ID P31044
mRNA ID NM_017236
Length 187
MAADISQWAGPLSLQEVDEPPQHALRVDYGGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRKDPKFREWHHFLVVNMKGNDISSGTVLSEYVGSGPPKDTGLHRYVWLVYEQEQPLNCDEPILSNKSGDNRGKFKVESFRKKYHLGAPVAGTCFQAEWDDSVPKLHDQLAGK

Gene Information

Entrez Gene ID
29542
Gene Name
phosphatidylethanolamine binding protein 1
Gene Symbol
Pebp1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IDA:RGD C Golgi apparatus
GO:0045177 IDA:RGD C apical part of cell
GO:0043679 IDA:RGD C axon terminus
GO:0009986 IDA:RGD C cell surface
GO:0005737 IDA:RGD C cytoplasm
GO:0005615 IDA:RGD C extracellular space
GO:0005741 IDA:RGD C mitochondrial outer membrane
GO:0005739 IDA:RGD C mitochondrion
GO:0043005 IDA:RGD C neuron projection
GO:0043025 IDA:RGD C neuronal cell body
GO:0005791 IDA:RGD C rough endoplasmic reticulum
GO:0008021 IDA:RGD C synaptic vesicle
GO:0005524 IDA:RGD F ATP binding
GO:0019900 IPI:RGD F kinase binding
GO:0008289 TAS:RGD F lipid binding
GO:0051019 IDA:RGD F mitogen-activated protein kinase binding
GO:0019901 IPI:RGD F protein kinase binding
GO:0005102 IDA:RGD F receptor binding
GO:0004867 IEA:UniProtKB-KW F serine-type endopeptidase inhibitor activity
GO:0000165 IDA:RGD P MAPK cascade
GO:0007568 IEP:RGD P aging
GO:0007420 IEP:RGD P brain development
GO:0042755 IEP:RGD P eating behavior
GO:0043409 IMP:RGD P negative regulation of MAPK cascade
GO:0001933 IMP:RGD P negative regulation of protein phosphorylation
GO:0060409 IDA:RGD P positive regulation of acetylcholine metabolic process
GO:0043950 IMP:RGD P positive regulation of cAMP-mediated signaling
GO:0045840 IMP:RGD P positive regulation of mitosis
GO:0001505 IDA:RGD P regulation of neurotransmitter levels
GO:0002026 IDA:RGD P regulation of the force of heart contraction
GO:0014823 IEP:RGD P response to activity
GO:0051591 IEP:RGD P response to cAMP
GO:0051592 IEP:RGD P response to calcium ion
GO:0051412 IEP:RGD P response to corticosterone
GO:0042493 IEP:RGD P response to drug
GO:0051602 IEP:RGD P response to electrical stimulus
GO:0045471 IEP:RGD P response to ethanol
GO:0009408 IEP:RGD P response to heat
GO:0014070 IEP:RGD P response to organic cyclic compound
GO:0010033 IEP:RGD P response to organic substance
GO:0010243 IEP:RGD P response to organonitrogen compound
GO:0006979 IEP:RGD P response to oxidative stress
GO:0009636 IEP:RGD P response to toxic substance
GO:0009611 IEP:RGD P response to wounding
GO:0048240 IEA:Ensembl P sperm capacitation
GO:0007286 IEP:RGD P spermatid development

Domain Information

InterPro Annotations

Accession Description
IPR008914 Phosphatidylethanolamine-binding protein PEBP
IPR001858 Phosphatidylethanolamine-binding, conserved site

UniProt Annotations

Entry Information

Gene Name
phosphatidylethanolamine binding protein 1
Protein Entry
PEBP1_RAT
UniProt ID
P31044
Species
Rat

Comments

Comment Type Description
Function Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase (By similarity). Inhibits the kinase activity of RAF1 by inhibiting its activation and by dissociating the RAF1/MEK complex and acting as a competitive inhibitor of MEK phosphorylation (By similarity)
Function HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor.
Miscellaneous Seems to be associated with memory and learning disorder.
Similarity Belongs to the phosphatidylethanolamine-binding protein family
Subcellular Location Cytoplasm. Membrane; Peripheral membrane protein.
Subunit Has a tendency to form dimers by disulfide cross-linking. Interacts with RAF1 and this interaction is enhanced if RAF1 is phosphorylated on residues 'Ser-338', 'Ser-339', 'Tyr-340' and 'Tyr-341'. Interacts with ALOX15; in response to IL13/interleukin- 13, prevents the interaction of PEBP1 with RAF1 to activate the ERK signaling cascade (By similarity)
Tissue Specificity Major component of epididymal secretions and sperm plasma membranes. It is present in cytosols from a variety of other tissues. Highly expressed in brain.

Identical and Related Proteins

Unique RefSeq proteins for LMP012607 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
8393910 RefSeq NP_058932 187 phosphatidylethanolamine-binding protein 1

Identical Sequences to LMP012607 proteins

Reference Database Accession Length Protein Name
GI:8393910 GenBank AAQ40680.1 187 Sequence 7 from patent US 6573430
GI:8393910 GenBank AAH63171.1 187 Phosphatidylethanolamine binding protein 1 [Rattus norvegicus]
GI:8393910 GenBank ABN26885.1 187 Sequence 7 from patent US 7157279
GI:8393910 GenBank EDM13831.1 187 phosphatidylethanolamine binding protein 1, isoform CRA_c [Rattus norvegicus]

Related Sequences to LMP012607 proteins

Reference Database Accession Length Protein Name
GI:8393910 GenBank AAQ40680.1 187 Sequence 7 from patent US 6573430
GI:8393910 GenBank AAH63171.1 187 Phosphatidylethanolamine binding protein 1 [Rattus norvegicus]
GI:8393910 GenBank ABN26885.1 187 Sequence 7 from patent US 7157279