Gene/Proteome Database (LMPD)

LMPD ID
LMP012617
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
arachidonate 5-lipoxygenase activating protein
Gene Symbol
Alternate Names
arachidonate 5-lipoxygenase-activating protein; FLAP; MK-886-binding protein; 5-lipoxygenase-activating protein FLAP;
Chromosome
12
Map Location
12p11
Summary
involved in leukotriene synthesis; plays a role in immediate hypersensitivity response [RGD, Feb 2006]
Orthologs

Proteins

arachidonate 5-lipoxygenase-activating protein
Refseq ID NP_058956
Protein GI 8392897
UniProt ID P20291
mRNA ID NM_017260
Length 161
MDQEAVGNVVLLAIVTLISVVQNAFFAHKVELESKAQSGRSFQRTGTLAFERVYTANQNCVDAYPTFLVVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSLAGILNHYLIFFFGSDFENYIRTITTTISPLLLIP

Gene Information

Entrez Gene ID
Gene Name
arachidonate 5-lipoxygenase activating protein
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IDA:RGD C cytosol
GO:0005783 IDA:RGD C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 TAS:RGD C membrane
GO:0005635 ISS:UniProtKB C nuclear envelope
GO:0031965 ISS:UniProtKB C nuclear membrane
GO:0050544 ISS:UniProtKB F arachidonic acid binding
GO:0008047 IEA:InterPro F enzyme activator activity
GO:0019899 IPI:RGD F enzyme binding
GO:0046982 IPI:RGD F protein heterodimerization activity
GO:0042803 IDA:RGD F protein homodimerization activity
GO:0071277 IEA:Ensembl P cellular response to calcium ion
GO:0019370 IDA:RGD P leukotriene biosynthetic process
GO:0002540 IEA:Ensembl P leukotriene production involved in inflammatory response
GO:0019372 IDA:RGD P lipoxygenase pathway
GO:0055114 IDA:GOC P oxidation-reduction process
GO:0002675 IMP:RGD P positive regulation of acute inflammatory response
GO:0070207 IDA:RGD P protein homotrimerization

REACTOME Pathway Links

REACTOME Pathway ID Description
5953493 Arachidonic acid metabolism
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5954095 Synthesis of 5-eicosatetraenoic acids
5954082 Synthesis of Leukotrienes (LT) and Eoxins (EX)
5954552 Synthesis of Lipoxins (LX)

Domain Information

InterPro Annotations

Accession Description
IPR001446 5-lipoxygenase-activating protein
IPR018295 FLAP/GST2/LTC4S, conserved site
IPR023352 Membrane associated eicosanoid/glutathione metabolism-like domain
IPR001129 Membrane-associated, eicosanoid/glutathione metabolism (MAPEG) protein

UniProt Annotations

Entry Information

Gene Name
arachidonate 5-lipoxygenase activating protein
Protein Entry
AL5AP_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Domain The C-terminal part after residue 140 is mostly disordered
Function Required for leukotriene biosynthesis by ALOX5 (5- lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes. unstructured (By similarity)
Similarity Belongs to the MAPEG family
Subcellular Location Nucleus membrane ; Multi-pass membrane protein . Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein .
Subunit Homotrimer. Interacts with LTC4S and ALOX5 (By similarity)

Identical and Related Proteins

Unique RefSeq proteins for LMP012617 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
8392897 RefSeq NP_058956 161 arachidonate 5-lipoxygenase-activating protein

Identical Sequences to LMP012617 proteins

Reference Database Accession Length Protein Name
GI:8392897 GenBank AAH86593.1 161 Arachidonate 5-lipoxygenase activating protein [Rattus norvegicus]
GI:8392897 GenBank EDL89525.1 161 arachidonate 5-lipoxygenase activating protein [Rattus norvegicus]
GI:8392897 GenBank AEK13630.1 161 Sequence 42 from patent US 7972785
GI:8392897 SwissProt P20291.2 161 RecName: Full=Arachidonate 5-lipoxygenase-activating protein; AltName: Full=FLAP; AltName: Full=MK-886-binding protein [Rattus norvegicus]

Related Sequences to LMP012617 proteins

Reference Database Accession Length Protein Name
GI:8392897 GenBank AAH86593.1 161 Arachidonate 5-lipoxygenase activating protein [Rattus norvegicus]
GI:8392897 GenBank AEK13630.1 161 Sequence 42 from patent US 7972785
GI:8392897 PRF - 161 lipoxygenase activating protein [Rattus norvegicus]