Gene/Proteome Database (LMPD)
LMPD ID
LMP012625
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
phospholipase A2, group IIA (platelets, synovial fluid)
Gene Symbol
Synonyms
sPLA2;
Alternate Names
phospholipase A2, membrane associated; GIIC sPLA2; platelet phospholipase A2; group IIA phospholipase A2; eted enzyme type IIA phospholipase A2; phosphatidylcholine 2-acylhydrolase 2A;
Chromosome
5
Map Location
5q36
EC Number
3.1.1.4
Summary
hydrolyzes acyl group at the sn-2 position of phospholipids, forming non-esterified fatty acids and lysophospholipids; plays a critical role in inflammation; induces proliferation of smooth muscle cells [RGD, Feb 2006]
Orthologs
Proteins
phospholipase A2, membrane associated precursor | |
---|---|
Refseq ID | NP_113786 |
Protein GI | 291621686 |
UniProt ID | P14423 |
mRNA ID | NM_031598 |
Length | 146 |
MKVLLLLAVVIMAFGSIQVQGSLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC | |
sig_peptide: 1..21 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2231 peptide sequence: MKVLLLLAVVIMAFGSIQVQG mat_peptide: 22..146 product: Phospholipase A2, membrane associated experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P14423.2) calculated_mol_wt: 14081 peptide sequence: SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC |
Gene Information
Entrez Gene ID
Gene Name
phospholipase A2, group IIA (platelets, synovial fluid)
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
GO:0005615 | IEA:Ensembl | C | extracellular space |
GO:0016020 | IEA:UniProtKB-KW | C | membrane |
GO:0005739 | IEA:Ensembl | C | mitochondrion |
GO:0048471 | IDA:RGD | C | perinuclear region of cytoplasm |
GO:0030141 | IDA:RGD | C | secretory granule |
GO:0005509 | IEA:InterPro | F | calcium ion binding |
GO:0047498 | IDA:RGD | F | calcium-dependent phospholipase A2 activity |
GO:0004623 | TAS:RGD | F | phospholipase A2 activity |
GO:0005543 | IEA:Ensembl | F | phospholipid binding |
GO:0016042 | TAS:RGD | P | lipid catabolic process |
GO:0050680 | IEA:Ensembl | P | negative regulation of epithelial cell proliferation |
GO:0046473 | IEA:Ensembl | P | phosphatidic acid metabolic process |
GO:0006644 | IDA:RGD | P | phospholipid metabolic process |
GO:0035019 | IEA:Ensembl | P | somatic stem cell maintenance |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00590 | Arachidonic acid metabolism |
rno00590 | Arachidonic acid metabolism |
ko00565 | Ether lipid metabolism |
rno00565 | Ether lipid metabolism |
ko04975 | Fat digestion and absorption |
rno04975 | Fat digestion and absorption |
ko00564 | Glycerophospholipid metabolism |
rno00564 | Glycerophospholipid metabolism |
ko00591 | Linoleic acid metabolism |
rno00591 | Linoleic acid metabolism |
rno01100 | Metabolic pathways |
ko04972 | Pancreatic secretion |
rno04972 | Pancreatic secretion |
rno04014 | Ras signaling pathway |
ko04270 | Vascular smooth muscle contraction |
rno04270 | Vascular smooth muscle contraction |
ko00592 | alpha-Linolenic acid metabolism |
rno00592 | alpha-Linolenic acid metabolism |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5954464 | Acyl chain remodelling of PC |
5954471 | Acyl chain remodelling of PE |
5954465 | Acyl chain remodelling of PG |
5954468 | Acyl chain remodelling of PI |
5954470 | Acyl chain remodelling of PS |
5953473 | Glycerophospholipid biosynthesis |
5953250 | Metabolism |
5953289 | Metabolism of lipids and lipoproteins |
5953474 | Phospholipid metabolism |
5953472 | Synthesis of PA |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phospholipase A2, group IIA (platelets, synovial fluid)
Protein Entry
PA2GA_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. {ECO:0000255|PROSITE- ProRule:PRU10035, ECO:0000255|PROSITE-ProRule:PRU10036}. |
Cofactor | Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence= ; Note=Binds 1 Ca(2+) ion per subunit. ; |
Function | Thought to participate in the regulation of the phospholipid metabolism in biomembranes including eicosanoid biosynthesis. Catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. |
Miscellaneous | Group II phospholipase A2 is found in many cells and also extracellularly. The membrane-bound and secreted forms are identical and are encoded by a single gene. |
Similarity | Belongs to the phospholipase A2 family |
Subcellular Location | Membrane; Peripheral membrane protein. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012625 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
291621686 | RefSeq | NP_113786 | 146 | phospholipase A2, membrane associated precursor |
Identical Sequences to LMP012625 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:291621686 | DBBJ | BAA00410.1 | 146 | phospholipase A2 precursor [Rattus norvegicus] |
GI:291621686 | GenBank | EDL80890.1 | 146 | phospholipase A2, group IIA (platelets, synovial fluid), isoform CRA_a [Rattus norvegicus] |
GI:291621686 | GenBank | AEU43268.1 | 146 | Sequence 17 from patent US 8052970 |
GI:291621686 | RefSeq | XP_006239208.1 | 146 | PREDICTED: phospholipase A2, membrane associated isoform X1 [Rattus norvegicus] |
Related Sequences to LMP012625 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:291621686 | GenBank | EDL80890.1 | 146 | phospholipase A2, group IIA (platelets, synovial fluid), isoform CRA_a [Rattus norvegicus] |
GI:291621686 | RefSeq | XP_006239208.1 | 146 | PREDICTED: phospholipase A2, membrane associated isoform X1 [Rattus norvegicus] |
GI:291621686 | SwissProt | P14423.2 | 146 | RecName: Full=Phospholipase A2, membrane associated; AltName: Full=GIIC sPLA2; AltName: Full=Group IIA phospholipase A2; AltName: Full=Phosphatidylcholine 2-acylhydrolase 2A; Flags: Precursor [Rattus norvegicus] |