Gene/Proteome Database (LMPD)

LMPD ID
LMP012634
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9)
Gene Symbol
Alternate Names
ATP synthase F(0) complex subunit C1, mitochondrial; ATPase protein 9; ATPase subunit c; ATP synthase proteolipid P1; ATP synthase lipid-binding protein, mitochondrial; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9); ATP synthase H+ transporting mitochondrial F0 complex subunit c (subunit 9) isoform 1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1;
Chromosome
10
Map Location
10q31
Summary
isoform of mitochondril ATP synthase subunit 9; increased expression occurs in response to ethanol consumption [RGD, Feb 2006]
Orthologs

Proteins

ATP synthase F(0) complex subunit C1, mitochondrial precursor
Refseq ID NP_059007
Protein GI 8392939
UniProt ID Q06645
mRNA ID NM_017311
Length 136
MQTTKALLISPVLIRSCTRGLIRPVSASLLSRPEAPSKKPSCCSSPLQVARREFQTSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
transit_peptide: 1..61 experiment: experimental evidence, no additional details recorded note: Mitochondrion; propagated from UniProtKB/Swiss-Prot (Q06645.1) calculated_mol_wt: 6654 peptide sequence: MQTTKALLISPVLIRSCTRGLIRPVSASLLSRPEAPSKKPSCCSSPLQVARREFQTSVISR mat_peptide: 62..136 product: ATP synthase F(0) complex subunit C1, mitochondrial calculated_mol_wt: 7608 peptide sequence: DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

Gene Information

Entrez Gene ID
Gene Name
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9)
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005753 IDA:UniProtKB C mitochondrial proton-transporting ATP synthase complex
GO:0000276 IDA:RGD C mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)
GO:0005739 NAS:RGD C mitochondrion
GO:0015078 IEA:InterPro F hydrogen ion transmembrane transporter activity
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0015991 IEA:InterPro P ATP hydrolysis coupled proton transport
GO:0046034 IDA:RGD P ATP metabolic process
GO:0015986 IEA:InterPro P ATP synthesis coupled proton transport
GO:0045471 IEP:RGD P response to ethanol

KEGG Pathway Links

KEGG Pathway ID Description
ko05010 Alzheimer's disease
rno05010 Alzheimer's disease
M00158 F-type ATPase, eukaryotes
ko05016 Huntington's disease
rno05016 Huntington's disease
rno01100 Metabolic pathways
ko00190 Oxidative phosphorylation
rno00190 Oxidative phosphorylation
rno05012 Parkinson's disease

REACTOME Pathway Links

REACTOME Pathway ID Description
5953764 Formation of ATP by chemiosmotic coupling
5953250 Metabolism
5953345 Metabolism of proteins
5954431 Mitochondrial protein import
5953748 Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.
5953270 The citric acid (TCA) cycle and respiratory electron transport

Domain Information

InterPro Annotations

Accession Description
IPR000454 ATPase, F0 complex, subunit C
IPR020537 ATPase, F0 complex, subunit C, DCCD-binding site
IPR002379 V-ATPase proteolipid subunit C-like domain

UniProt Annotations

Entry Information

Gene Name
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9)
Protein Entry
AT5G1_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Disease Note=This protein is the major protein stored in the storage bodies of animals or humans affected with ceroid lipofuscinosis (Batten disease).
Function Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element.
Miscellaneous There are three genes which encode the mitochondrial ATP synthase proteolipid and they specify precursors with different import sequences. They are expressed in a tissue- specific manner.
Similarity Belongs to the ATPase C chain family
Subcellular Location Mitochondrion membrane; Multi-pass membrane protein.
Subunit F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Component of an ATP synthase complex composed of ATP5F1, ATP5G1, ATP5E, ATP5H, ATP5I, ATP5J, ATP5J2, MT-ATP6, MT-ATP8, ATP5A1, ATP5B, ATP5D, ATP5C1, ATP5O, ATP5L, USMG5 and MP68

Identical and Related Proteins

Unique RefSeq proteins for LMP012634 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
8392939 RefSeq NP_059007 136 ATP synthase F(0) complex subunit C1, mitochondrial precursor

Identical Sequences to LMP012634 proteins

Reference Database Accession Length Protein Name
GI:8392939 GenBank EDM05785.1 136 rCG33837, isoform CRA_a [Rattus norvegicus]
GI:8392939 GenBank EDM05786.1 136 rCG33837, isoform CRA_a [Rattus norvegicus]
GI:8392939 RefSeq XP_006247250.1 136 PREDICTED: ATP synthase F(0) complex subunit C1, mitochondrial isoform X1 [Rattus norvegicus]
GI:8392939 RefSeq XP_006247251.1 136 PREDICTED: ATP synthase F(0) complex subunit C1, mitochondrial isoform X1 [Rattus norvegicus]

Related Sequences to LMP012634 proteins

Reference Database Accession Length Protein Name
GI:8392939 RefSeq XP_006247250.1 136 PREDICTED: ATP synthase F(0) complex subunit C1, mitochondrial isoform X1 [Rattus norvegicus]
GI:8392939 RefSeq XP_006247251.1 136 PREDICTED: ATP synthase F(0) complex subunit C1, mitochondrial isoform X1 [Rattus norvegicus]
GI:8392939 SwissProt Q06645.1 136 RecName: Full=ATP synthase F(0) complex subunit C1, mitochondrial; AltName: Full=ATP synthase lipid-binding protein; AltName: Full=ATP synthase proteolipid P1; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor [Rattus norvegicus]