Gene/Proteome Database (LMPD)
LMPD ID
LMP012634
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9)
Gene Symbol
Alternate Names
ATP synthase F(0) complex subunit C1, mitochondrial; ATPase protein 9; ATPase subunit c; ATP synthase proteolipid P1; ATP synthase lipid-binding protein, mitochondrial; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9); ATP synthase H+ transporting mitochondrial F0 complex subunit c (subunit 9) isoform 1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1;
Chromosome
10
Map Location
10q31
Summary
isoform of mitochondril ATP synthase subunit 9; increased expression occurs in response to ethanol consumption [RGD, Feb 2006]
Orthologs
Proteins
ATP synthase F(0) complex subunit C1, mitochondrial precursor | |
---|---|
Refseq ID | NP_059007 |
Protein GI | 8392939 |
UniProt ID | Q06645 |
mRNA ID | NM_017311 |
Length | 136 |
MQTTKALLISPVLIRSCTRGLIRPVSASLLSRPEAPSKKPSCCSSPLQVARREFQTSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM | |
transit_peptide: 1..61 experiment: experimental evidence, no additional details recorded note: Mitochondrion; propagated from UniProtKB/Swiss-Prot (Q06645.1) calculated_mol_wt: 6654 peptide sequence: MQTTKALLISPVLIRSCTRGLIRPVSASLLSRPEAPSKKPSCCSSPLQVARREFQTSVISR mat_peptide: 62..136 product: ATP synthase F(0) complex subunit C1, mitochondrial calculated_mol_wt: 7608 peptide sequence: DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM |
Gene Information
Entrez Gene ID
Gene Name
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9)
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005753 | IDA:UniProtKB | C | mitochondrial proton-transporting ATP synthase complex |
GO:0000276 | IDA:RGD | C | mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) |
GO:0005739 | NAS:RGD | C | mitochondrion |
GO:0015078 | IEA:InterPro | F | hydrogen ion transmembrane transporter activity |
GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
GO:0015991 | IEA:InterPro | P | ATP hydrolysis coupled proton transport |
GO:0046034 | IDA:RGD | P | ATP metabolic process |
GO:0015986 | IEA:InterPro | P | ATP synthesis coupled proton transport |
GO:0045471 | IEP:RGD | P | response to ethanol |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko05010 | Alzheimer's disease |
rno05010 | Alzheimer's disease |
M00158 | F-type ATPase, eukaryotes |
ko05016 | Huntington's disease |
rno05016 | Huntington's disease |
rno01100 | Metabolic pathways |
ko00190 | Oxidative phosphorylation |
rno00190 | Oxidative phosphorylation |
rno05012 | Parkinson's disease |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5953764 | Formation of ATP by chemiosmotic coupling |
5953250 | Metabolism |
5953345 | Metabolism of proteins |
5954431 | Mitochondrial protein import |
5953748 | Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. |
5953270 | The citric acid (TCA) cycle and respiratory electron transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9)
Protein Entry
AT5G1_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Disease | Note=This protein is the major protein stored in the storage bodies of animals or humans affected with ceroid lipofuscinosis (Batten disease). |
Function | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element. |
Miscellaneous | There are three genes which encode the mitochondrial ATP synthase proteolipid and they specify precursors with different import sequences. They are expressed in a tissue- specific manner. |
Similarity | Belongs to the ATPase C chain family |
Subcellular Location | Mitochondrion membrane; Multi-pass membrane protein. |
Subunit | F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Component of an ATP synthase complex composed of ATP5F1, ATP5G1, ATP5E, ATP5H, ATP5I, ATP5J, ATP5J2, MT-ATP6, MT-ATP8, ATP5A1, ATP5B, ATP5D, ATP5C1, ATP5O, ATP5L, USMG5 and MP68 |
Identical and Related Proteins
Unique RefSeq proteins for LMP012634 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
8392939 | RefSeq | NP_059007 | 136 | ATP synthase F(0) complex subunit C1, mitochondrial precursor |
Identical Sequences to LMP012634 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:8392939 | GenBank | EDM05785.1 | 136 | rCG33837, isoform CRA_a [Rattus norvegicus] |
GI:8392939 | GenBank | EDM05786.1 | 136 | rCG33837, isoform CRA_a [Rattus norvegicus] |
GI:8392939 | RefSeq | XP_006247250.1 | 136 | PREDICTED: ATP synthase F(0) complex subunit C1, mitochondrial isoform X1 [Rattus norvegicus] |
GI:8392939 | RefSeq | XP_006247251.1 | 136 | PREDICTED: ATP synthase F(0) complex subunit C1, mitochondrial isoform X1 [Rattus norvegicus] |
Related Sequences to LMP012634 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:8392939 | RefSeq | XP_006247250.1 | 136 | PREDICTED: ATP synthase F(0) complex subunit C1, mitochondrial isoform X1 [Rattus norvegicus] |
GI:8392939 | RefSeq | XP_006247251.1 | 136 | PREDICTED: ATP synthase F(0) complex subunit C1, mitochondrial isoform X1 [Rattus norvegicus] |
GI:8392939 | SwissProt | Q06645.1 | 136 | RecName: Full=ATP synthase F(0) complex subunit C1, mitochondrial; AltName: Full=ATP synthase lipid-binding protein; AltName: Full=ATP synthase proteolipid P1; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor [Rattus norvegicus] |