Gene/Proteome Database (LMPD)
LMPD ID
LMP012654
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
apolipoprotein M
Gene Symbol
Alternate Names
apolipoprotein M; apo-M; protein Px;
Chromosome
20
Map Location
20p12
Summary
human homolog is a lipoprotein associated with high density lipoprotein (HDL) particles [RGD, Feb 2006]
Orthologs
Proteins
apolipoprotein M precursor | |
---|---|
Refseq ID | NP_062246 |
Protein GI | 9506391 |
UniProt ID | P14630 |
mRNA ID | NM_019373 |
Length | 190 |
MFHQVWAALLYLYGLLFNSMNQCPEHSQLMTLGMDDKETPEPHLGLWYFIAGAAPTMEELATFDQVDNIVFNMAAGSAPRQLQLRATIRTKNGVCVPRKWTYHLTEGKGNTELRTEGRPDMKTDLFSISCPGGIMLKETGQGYQRFLLYNRSPHPPEECVEEFQSLTSCLDFKAFLVTPRNQEACPLSSK | |
sig_peptide: 1..17 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P14630.2) calculated_mol_wt: 2086 peptide sequence: MFHQVWAALLYLYGLLF mat_peptide: 18..190 product: Apolipoprotein M experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P14630.2) calculated_mol_wt: 19445 peptide sequence: NSMNQCPEHSQLMTLGMDDKETPEPHLGLWYFIAGAAPTMEELATFDQVDNIVFNMAAGSAPRQLQLRATIRTKNGVCVPRKWTYHLTEGKGNTELRTEGRPDMKTDLFSISCPGGIMLKETGQGYQRFLLYNRSPHPPEECVEEFQSLTSCLDFKAFLVTPRNQEACPLSSK |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0034365 | IEA:Ensembl | C | discoidal high-density lipoprotein particle |
GO:0005615 | IDA:RGD | C | extracellular space |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0034362 | IEA:Ensembl | C | low-density lipoprotein particle |
GO:0034366 | IEA:Ensembl | C | spherical high-density lipoprotein particle |
GO:0034361 | IEA:Ensembl | C | very-low-density lipoprotein particle |
GO:0016209 | IEA:Ensembl | F | antioxidant activity |
GO:0005319 | IEA:Ensembl | F | lipid transporter activity |
GO:0005543 | IEA:Ensembl | F | phospholipid binding |
GO:0033344 | IEA:Ensembl | P | cholesterol efflux |
GO:0034380 | IEA:Ensembl | P | high-density lipoprotein particle assembly |
GO:0034384 | IEA:Ensembl | P | high-density lipoprotein particle clearance |
GO:0034375 | IEA:Ensembl | P | high-density lipoprotein particle remodeling |
GO:0042157 | IEA:Ensembl | P | lipoprotein metabolic process |
GO:0034445 | IEA:Ensembl | P | negative regulation of plasma lipoprotein particle oxidation |
GO:0009749 | IEP:RGD | P | response to glucose |
GO:0043691 | IEA:Ensembl | P | reverse cholesterol transport |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Probably involved in lipid transport. Can bind sphingosine-1-phosphate, myristic acid, palmitic acid and stearic acid, retinol, all-trans-retinoic acid and 9-cis-retinoic acid (By similarity) |
Similarity | Belongs to the calycin superfamily. Lipocalin family. Highly divergent |
Subcellular Location | Secreted. Note=Associated with HDL. |
Tissue Specificity | Expressed by the liver; secreted in plasma. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012654 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
9506391 | RefSeq | NP_062246 | 190 | apolipoprotein M precursor |
Identical Sequences to LMP012654 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:9506391 | EMBL | CAE83996.1 | 190 | apolipoprotein M [Rattus norvegicus] |
GI:9506391 | GenBank | AAH89807.1 | 190 | Apolipoprotein M [Rattus norvegicus] |
GI:9506391 | GenBank | EDL83529.1 | 190 | apolipoprotein M [Rattus norvegicus] |
GI:9506391 | SwissProt | P14630.2 | 190 | RecName: Full=Apolipoprotein M; Short=Apo-M; Short=ApoM; AltName: Full=Protein Px; Flags: Precursor [Rattus norvegicus] |
Related Sequences to LMP012654 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:9506391 | EMBL | CAE83996.1 | 190 | apolipoprotein M [Rattus norvegicus] |
GI:9506391 | GenBank | AAF23408.1 | 190 | apolipoprotein M [Rattus norvegicus] |
GI:9506391 | GenBank | EDL83529.1 | 190 | apolipoprotein M [Rattus norvegicus] |