Gene/Proteome Database (LMPD)

LMPD ID
LMP012660
Gene ID
58850
Species
Rattus norvegicus (Rat)
Gene Name
nuclear receptor subfamily 0, group B, member 1
Gene Symbol
Nr0b1
Synonyms
Ahch; DAX-1;
Alternate Names
nuclear receptor subfamily 0 group B member 1; nuclear receptor DAX-1; adrenal hypoplasia, congenital homolog;
Chromosome
X
Map Location
Xq22
Summary
human homolog is an orphan nuclear hormone receptor [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Nr0b1

Proteins

nuclear receptor subfamily 0 group B member 1
Refseq ID NP_445769
Protein GI 16758012
UniProt ID P70503
mRNA ID NM_053317
Length 472
MAGEDHPWHGSILYNLLMSAKQKHGSREEREVRLGAQCWGCACGTQPVLGGEGLPGGQALSLLYRCCFCGENHPRQGGILYSMLTNARQPSGATEAPRARFRTPCWGCACSNAKPLVGRXGLPAGQVPSLLYRCCFCGKKHPRQGSILYSLLTNAQQTHVSREVPEAHRGGEWWQLSYCTHNVGGPEGLQSTQAMAFLYRSYVCCEEQPQQSSVASDTPVRADQTPAAPQEQPRAPWWDTSSGVQRPIALKDPQVVCEAASAGLLKTLRFVKYLPCFQILPLDQQLVLVRSCWAPLLMLELAQDHLHFEMMEISEPNLMHEMLTTRRQETEGPEPADPQATEQPQTVSAEAGHVLSVAAVQAIKSFFFKCWSLNIDTKEYAYLKGTVLFNPDLPGLQCVKYIESLQWRTQQILTEHIRLMQREYQIRSAELNSALFLLRFINTDVVTELFFRPIIGAVSMDDMMLEMLCAKL

Gene Information

Entrez Gene ID
58850
Gene Name
nuclear receptor subfamily 0, group B, member 1
Gene Symbol
Nr0b1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:RGD C cytoplasm
GO:0005634 ISS:HGNC C nucleus
GO:0042788 ISS:HGNC C polysomal ribosome
GO:0003677 ISS:HGNC F DNA binding
GO:0032448 ISS:HGNC F DNA hairpin binding
GO:0003723 ISS:HGNC F RNA binding
GO:0003690 IMP:RGD F double-stranded DNA binding
GO:0004879 ISS:BHF-UCL F ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity
GO:0043565 ISS:HGNC F sequence-specific DNA binding
GO:0003707 IEA:InterPro F steroid hormone receptor activity
GO:0030325 ISS:HGNC P adrenal gland development
GO:0008406 ISS:HGNC P gonad development
GO:0030522 ISS:GOC P intracellular receptor signaling pathway
GO:0043433 IMP:RGD P negative regulation of sequence-specific DNA binding transcription factor activity
GO:0000122 IMP:RGD P negative regulation of transcription from RNA polymerase II promoter
GO:0045892 ISS:HGNC P negative regulation of transcription, DNA-templated
GO:0050810 TAS:RGD P regulation of steroid biosynthetic process
GO:0010033 IEP:RGD P response to organic substance
GO:0043434 IEP:RGD P response to peptide hormone
GO:0007283 IEP:RGD P spermatogenesis
GO:0006694 ISS:HGNC P steroid biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR025900 Nuclear_receptor_repeat
IPR001723 Steroid hormone receptor

UniProt Annotations

Entry Information

Gene Name
nuclear receptor subfamily 0, group B, member 1
Protein Entry
NR0B1_RAT
UniProt ID
P70503
Species
Rat

Comments

Comment Type Description
Domain Homodimerization involved an interaction between amino and carboxy termini involving LXXLL motifs and steroid binding domain (AF-2 motif). Heterodimerizes with NR5A1 and NROB2 through its N- terminal LXXLL motifs (By similarity)
Function Orphan nuclear receptor. Component of a cascade required for the development of the hypothalamic-pituitary-adrenal-gonadal axis. Acts as a coregulatory protein that inhibits the transcriptional activity of other nuclear receptors through heterodimeric interactions. May also have a role in the development of the embryo and in the maintenance of embryonic stem cell pluripotency (By similarity)
Similarity Belongs to the nuclear hormone receptor family. NR0 subfamily
Subcellular Location Nucleus . Cytoplasm . Note=Shuttles between the cytoplasm and nucleus. Homodimers exits in the cytoplasm and in the nucleus (By similarity)
Subunit Homodimer. Interacts with NR5A1, NR5A2, NR0B2 and with COPS2 (By similarity)

Identical and Related Proteins

Unique RefSeq proteins for LMP012660 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16758012 RefSeq NP_445769 472 nuclear receptor subfamily 0 group B member 1

Identical Sequences to LMP012660 proteins

Reference Database Accession Length Protein Name
GI:16758012 EMBL CAA67832.1 472 DAX-1 [Rattus norvegicus]
GI:16758012 SwissProt P70503.1 472 RecName: Full=Nuclear receptor subfamily 0 group B member 1; AltName: Full=Nuclear receptor DAX-1 [Rattus norvegicus]

Related Sequences to LMP012660 proteins

Reference Database Accession Length Protein Name
GI:16758012 EMBL CAA67832.1 472 DAX-1 [Rattus norvegicus]
GI:16758012 GenBank EDL96046.1 472 nuclear receptor subfamily 0, group B, member 1 [Rattus norvegicus]
GI:16758012 SwissProt P70503.1 472 RecName: Full=Nuclear receptor subfamily 0 group B member 1; AltName: Full=Nuclear receptor DAX-1 [Rattus norvegicus]