Gene/Proteome Database (LMPD)

LMPD ID
LMP012665
Gene ID
58962
Species
Rattus norvegicus (Rat)
Gene Name
hematopoietic prostaglandin D synthase
Gene Symbol
Hpgds
Synonyms
Ptgds2;
Alternate Names
hematopoietic prostaglandin D synthase; H-PGDS; GST class-sigma; glutathione S-transferase; prostaglandin-H2 D-isomerase; glutathione-dependent PGD synthase; glutathione-dependent PGD synthetase; prostaglandin D2 synthase 2, hematopoietic; glutathione-requiring prostaglandin D synthase;
Chromosome
4
Map Location
4q31
EC Number
5.3.99.2
Summary
catalyzes the isomerization of prostaglandin H2 to prostaglandin D2 in prostaglandin biosynthesis [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Hpgds

Proteins

hematopoietic prostaglandin D synthase
Refseq ID NP_113832
Protein GI 13928888
UniProt ID O35543
mRNA ID NM_031644
Length 199
MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLTLHQSLAIARYLTKNTDLAGKTELEQCQVDAVVDTLDDFMSLFPWAEENQDLKERTFNDLLTRQAPHLLKDLDTYLGDKEWFIGNYVTWADFYWDICSTTLLVLKPDLLGIYPRLVSLRNKVQAIPAISAWILKRPQTKL

Gene Information

Entrez Gene ID
58962
Gene Name
hematopoietic prostaglandin D synthase
Gene Symbol
Hpgds
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0005509 ISS:UniProtKB F calcium ion binding
GO:0004364 IEA:UniProtKB-EC F glutathione transferase activity
GO:0000287 ISS:UniProtKB F magnesium ion binding
GO:0004667 ISS:UniProtKB F prostaglandin-D synthase activity
GO:0001516 TAS:RGD P prostaglandin biosynthetic process
GO:0006693 ISS:UniProtKB P prostaglandin metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00590 Arachidonic acid metabolism
rno00590 Arachidonic acid metabolism
rno01100 Metabolic pathways

REACTOME Pathway Links

REACTOME Pathway ID Description
5953493 Arachidonic acid metabolism
5953258 Biological oxidations
5953857 Glutathione conjugation
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953257 Phase II conjugation
5953492 Synthesis of Prostaglandins (PG) and Thromboxanes (TX)

Domain Information

InterPro Annotations

Accession Description
IPR004046 Glutathione S-transferase, C-terminal
IPR010987 Glutathione S-transferase, C-terminal-like
IPR004045 Glutathione S-transferase, N-terminal
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
hematopoietic prostaglandin D synthase
Protein Entry
HPGDS_RAT
UniProt ID
O35543
Species
Rat

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=100 uM for glutathione for the prostaglandin D synthase activity {ECO:0000269|PubMed:10871602, ECO:0000269|PubMed:11672424}; KM=500 uM for glutathione for the glutathione-conjugating activity {ECO:0000269|PubMed:10871602, ECO:0000269|PubMed:11672424}; KM=500 uM for PGH2 for the prostaglandin D synthase activity ; KM=3 mM for 1-chloro-2,4-dinitrobenzene ; Vmax=17.6 umol/min/mg enzyme with 1-bromo-2,4-dinitrobenzene as substrate {ECO:0000269|PubMed:10871602, ECO:0000269|PubMed:11672424}; Vmax=9.2 umol/min/mg enzyme with 1-chloro-2,4-dinitrobenzene as substrate {ECO:0000269|PubMed:10871602, ECO:0000269|PubMed:11672424}; Vmax=48.3 umol/min/mg enzyme with 1-fluoro-2,4-dinitrobenzene as substrate {ECO:0000269|PubMed:10871602, ECO:0000269|PubMed:11672424}; Vmax=17.9 umol/min/mg enzyme with 1-iodo-2,4-dinitrobenzene as substrate {ECO:0000269|PubMed:10871602, ECO:0000269|PubMed:11672424}; Vmax=0.35 umol/min/mg enzyme with cumene hydroperoxide as substrate {ECO:0000269|PubMed:10871602, ECO:0000269|PubMed:11672424}; Vmax=10.2 umol/min/mg enzyme with allyl isothiocyanate as substrate {ECO:0000269|PubMed:10871602, ECO:0000269|PubMed:11672424}; Vmax=11.3 umol/min/mg enzyme with benzyl isothiocyanate as substrate {ECO:0000269|PubMed:10871602, ECO:0000269|PubMed:11672424};
Catalytic Activity (5Z,13E,15S)-9-alpha,11-alpha-epidioxy-15- hydroxyprosta-5,13-dienoate = (5Z,13E,15S)-9-alpha,15-dihydroxy- 11-oxoprosta-5,13-dienoate.
Catalytic Activity RX + glutathione = HX + R-S-glutathione.
Cofactor Name=glutathione; Xref=ChEBI:CHEBI:57925; Evidence={ECO:0000269|PubMed:10871602, ECO:0000269|PubMed:11672424}; Note=Glutathione is required for the prostaglandin D synthase activity. {ECO:0000269|PubMed:10871602, ECO:0000269|PubMed:11672424};
Function Bifunctional enzyme which catalyzes both the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation, and the conjugation of glutathione with a wide range of aryl halides and organic isothiocyanates. Also exhibits low glutathione-peroxidase activity towards cumene hydroperoxide. {ECO:0000269|PubMed:10871602, ECO:0000269|PubMed:11672424, ECO:0000269|PubMed:16547010, ECO:0000269|PubMed:9323136}.
Sequence Caution Sequence=AAB72099.1; Type=Frameshift; Positions=73, 113; Evidence= ;
Similarity Belongs to the GST superfamily. Sigma family
Similarity Contains 1 GST C-terminal domain
Similarity Contains 1 GST N-terminal domain
Subcellular Location Cytoplasm.
Subunit Homodimer
Tissue Specificity Highly expressed in spleen and bone marrow. Lower levels of expression in small intestine, colon, liver, pancreas and skin. Not detected in brain, heart, lung or kidney (at protein level). {ECO:0000269|PubMed:11672424, ECO:0000269|PubMed:9323136}.

Identical and Related Proteins

Unique RefSeq proteins for LMP012665 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13928888 RefSeq NP_113832 199 hematopoietic prostaglandin D synthase

Identical Sequences to LMP012665 proteins

Reference Database Accession Length Protein Name
GI:13928888 GenBank AAH87590.1 199 Prostaglandin D2 synthase 2, hematopoietic [Rattus norvegicus]
GI:13928888 GenBank EDL91600.1 199 prostaglandin D2 synthase 2, isoform CRA_a [Rattus norvegicus]
GI:13928888 PDB 1PD2 199 Chain 1, Crystal Structure Of Hematopoietic Prostaglandin D Synthase Complex With Glutathione
GI:13928888 PDB 1PD2 199 Chain 2, Crystal Structure Of Hematopoietic Prostaglandin D Synthase Complex With Glutathione

Related Sequences to LMP012665 proteins

Reference Database Accession Length Protein Name
GI:13928888 DBBJ BAA22898.1 199 hematopoietic prostaglandin D synthase [Rattus norvegicus]
GI:13928888 GenBank AAH87590.1 199 Prostaglandin D2 synthase 2, hematopoietic [Rattus norvegicus]
GI:13928888 GenBank EDL91600.1 199 prostaglandin D2 synthase 2, isoform CRA_a [Rattus norvegicus]