Gene/Proteome Database (LMPD)

LMPD ID
LMP012669
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
prostaglandin E synthase
Gene Symbol
Synonyms
Pges;
Alternate Names
prostaglandin E synthase;
Chromosome
3
Map Location
3p12
Summary
catalyzes the conversion of PGH(2) to PGE(2) in prostaglandin biosynthesis [RGD, Feb 2006]
Orthologs

Proteins

prostaglandin E synthase
Refseq ID NP_067594
Protein GI 11024658
UniProt ID Q9JHF3
mRNA ID NM_021583
Length 153
MTSLGLVMENSQVLPAFLLCSTLLVIKMYAVAVITGQVRLRKKAFANPEDALKRGGLQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKMNPRIRSGAYVLAQFACFSMALQILWEVAHHL

Gene Information

Entrez Gene ID
Gene Name
prostaglandin E synthase
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:Ensembl C integral component of membrane
GO:0043231 IDA:RGD C intracellular membrane-bounded organelle
GO:0005641 IEA:Ensembl C nuclear envelope lumen
GO:0048471 IDA:RGD C perinuclear region of cytoplasm
GO:0043295 IEA:Ensembl F glutathione binding
GO:0050220 IDA:RGD F prostaglandin-E synthase activity
GO:0002526 IEP:RGD P acute inflammatory response
GO:0002544 IEP:RGD P chronic inflammatory response
GO:0008285 IEA:Ensembl P negative regulation of cell proliferation
GO:0001516 IDA:RGD P prostaglandin biosynthetic process
GO:0051592 IEP:RGD P response to calcium ion
GO:0034097 IEP:RGD P response to cytokine
GO:0032496 IEP:RGD P response to lipopolysaccharide
GO:0014070 IEP:RGD P response to organic cyclic compound
GO:0032526 IEP:RGD P response to retinoic acid

KEGG Pathway Links

KEGG Pathway ID Description
ko00590 Arachidonic acid metabolism
rno00590 Arachidonic acid metabolism
rno01100 Metabolic pathways

REACTOME Pathway Links

REACTOME Pathway ID Description
5953493 Arachidonic acid metabolism
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953492 Synthesis of Prostaglandins (PG) and Thromboxanes (TX)

Domain Information

InterPro Annotations

Accession Description
IPR023352 Membrane associated eicosanoid/glutathione metabolism-like domain
IPR001129 Membrane-associated, eicosanoid/glutathione metabolism (MAPEG) protein

UniProt Annotations

Entry Information

Gene Name
prostaglandin E synthase
Protein Entry
Q9JHF3_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP012669 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
11024658 RefSeq NP_067594 153 prostaglandin E synthase

Identical Sequences to LMP012669 proteins

Reference Database Accession Length Protein Name
GI:11024658 DBBJ BAB20597.1 153 inducible prostaglandin E synthase [Rattus norvegicus]
GI:11024658 GenBank AAI05859.1 153 Prostaglandin E synthase [Rattus norvegicus]
GI:11024658 GenBank EDL93288.1 153 prostaglandin E synthase [Rattus norvegicus]
GI:11024658 GenBank ADA21798.1 153 Sequence 6 from patent US 7608416

Related Sequences to LMP012669 proteins

Reference Database Accession Length Protein Name
GI:11024658 DBBJ BAA95808.1 153 PIG12 [Rattus norvegicus]
GI:11024658 GenBank AAI05859.1 153 Prostaglandin E synthase [Rattus norvegicus]
GI:11024658 GenBank ADA21798.1 153 Sequence 6 from patent US 7608416