Gene/Proteome Database (LMPD)
LMPD ID
LMP012672
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
inositol hexakisphosphate kinase 2
Gene Symbol
Synonyms
Pius; Ihpk2;
Alternate Names
inositol hexakisphosphate kinase 2; InsP6 kinase 2; P(i)-uptake stimulator; inositol hexaphosphate kinase 2;
Chromosome
8
Map Location
8q32
EC Number
2.7.4.21
Summary
activator protein for intestinal Na/Pi co-transport system; may play a role in the regulation of the intestinal Pi transport system by Pi restriction and 1;25-(OH)2D3 [RGD, Feb 2006]
Orthologs
Proteins
inositol hexakisphosphate kinase 2 | |
---|---|
Refseq ID | NP_067692 |
Protein GI | 158138537 |
UniProt ID | Q9R0U1 |
mRNA ID | NM_021660 |
Length | 425 |
MSPAFRTMDVEPRTKGILLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRRFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGPVDIVDNSDCEPKSKLLRWTNKKHHVLETEKSPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEVLYYSVEKKGTVSSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLTCRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGTGQLMFMNKYHGRKLSVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKEWPEVTLDSDAEDLEDLSEESADESAGAYAYKPLGASSVDVRMIDFAHTTCRLYGEDSVVHEGQDAGYIFGLQSLIDIVTEISEESGE |
Gene Information
Entrez Gene ID
Gene Name
inositol hexakisphosphate kinase 2
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0045111 | IEA:Ensembl | C | intermediate filament cytoskeleton |
GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
GO:0052723 | IEA:UniProtKB-EC | F | inositol hexakisphosphate 1-kinase activity |
GO:0052724 | IEA:UniProtKB-EC | F | inositol hexakisphosphate 3-kinase activity |
GO:0000832 | IEA:UniProtKB-EC | F | inositol hexakisphosphate 5-kinase activity |
GO:0008440 | IEA:InterPro | F | inositol-1,4,5-trisphosphate 3-kinase activity |
GO:0030308 | IEA:Ensembl | P | negative regulation of cell growth |
GO:0006817 | IDA:RGD | P | phosphate ion transport |
GO:0046854 | IEA:Ensembl | P | phosphatidylinositol phosphorylation |
GO:0043065 | IEA:Ensembl | P | positive regulation of apoptotic process |
REACTOME Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR005522 | Inositol polyphosphate kinase |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | ATP + 1D-myo-inositol 1-diphosphate 2,3,4,5,6- pentakisphosphate = ADP + 1D-myo-inositol 1,5-bis(diphosphate) 2,3,4,6-tetrakisphosphate. |
Catalytic Activity | ATP + 1D-myo-inositol hexakisphosphate = ADP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate. |
Function | Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4 (By similarity). Was first identified because of its ability to stimulate Na(+)- dependent phosphate cotransport. {ECO:0000250, ECO:0000269|PubMed:10527952}. |
Sequence Caution | Sequence=BAA87611.1; Type=Miscellaneous discrepancy; Note=Chimeric cDNA.; Evidence= ; |
Similarity | Belongs to the inositol phosphokinase (IPK) family |
Subcellular Location | Nucleus . |
Tissue Specificity | Highly expressed in small intestine |
Identical and Related Proteins
Unique RefSeq proteins for LMP012672 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
158138537 | RefSeq | NP_067692 | 425 | inositol hexakisphosphate kinase 2 |
Identical Sequences to LMP012672 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:158138537 | GenBank | AAH83574.1 | 425 | Inositol hexakisphosphate kinase 2 [Rattus norvegicus] |
GI:158138537 | GenBank | EDL77139.1 | 425 | inositol hexaphosphate kinase 2, isoform CRA_a [Rattus norvegicus] |
GI:158138537 | RefSeq | XP_008764786.1 | 425 | PREDICTED: inositol hexakisphosphate kinase 2 isoform X1 [Rattus norvegicus] |
GI:158138537 | SwissProt | Q9R0U1.2 | 425 | RecName: Full=Inositol hexakisphosphate kinase 2; Short=InsP6 kinase 2; AltName: Full=P(i)-uptake stimulator; Short=PiUS [Rattus norvegicus] |
Related Sequences to LMP012672 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:158138537 | GenBank | AAH83574.1 | 425 | Inositol hexakisphosphate kinase 2 [Rattus norvegicus] |
GI:158138537 | GenBank | EDL77139.1 | 425 | inositol hexaphosphate kinase 2, isoform CRA_a [Rattus norvegicus] |
GI:158138537 | RefSeq | XP_008764786.1 | 425 | PREDICTED: inositol hexakisphosphate kinase 2 isoform X1 [Rattus norvegicus] |