Gene/Proteome Database (LMPD)

LMPD ID
LMP012682
Gene ID
63864
Species
Rattus norvegicus (Rat)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 10
Gene Symbol
Hsd17b10
Synonyms
Hadh2;
Alternate Names
3-hydroxyacyl-CoA dehydrogenase type-2; type II HADH; 17-beta-HSD 10; mitochondrial RNase P protein 2; amyloid beta-peptide binding protein; mitochondrial ribonuclease P protein 2; 17-beta-hydroxysteroid dehydrogenase 10; 3-hydroxyacyl-CoA dehydrogenase type II; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; hydroxyacyl-Coenzyme A dehydrogenase type II; hydroxyacyl-Coenzyme A dehydrogenase, type II; short chain L-3-hydroxyacyl-CoA dehydrogenase; endoplasmic reticulum-associated amyloid beta-peptide-binding protein;
Chromosome
X
Map Location
Xq21
EC Number
1.1.1.35
Summary
a type 10 17beta-hydroxysteroid dehydrogenase enzyme of the mitochondria [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Hsd17b10

Proteins

3-hydroxyacyl-CoA dehydrogenase type-2
Refseq ID NP_113870
Protein GI 13994225
UniProt ID O70351
mRNA ID NM_031682
Length 261
MAAACRSVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTTLPDKVRNFLASQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP

Gene Information

Entrez Gene ID
63864
Gene Name
hydroxysteroid (17-beta) dehydrogenase 10
Gene Symbol
Hsd17b10
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 ISS:UniProtKB C mitochondrion
GO:0047015 IEA:UniProtKB-EC F 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity
GO:0003857 IEA:UniProtKB-EC F 3-hydroxyacyl-CoA dehydrogenase activity
GO:0051287 IDA:RGD F NAD binding
GO:0018454 IDA:RGD F acetoacetyl-CoA reductase activity
GO:0001540 IDA:RGD F beta-amyloid binding
GO:0004303 IDA:RGD F estradiol 17-beta-dehydrogenase activity
GO:0030331 IPI:RGD F estrogen receptor binding
GO:0042802 IDA:RGD F identical protein binding
GO:0005496 IDA:RGD F steroid binding
GO:0030283 IEA:UniProtKB-EC F testosterone dehydrogenase [NAD(P)] activity
GO:0033327 IEP:RGD P Leydig cell differentiation
GO:0007569 IEP:RGD P cell aging
GO:0051289 IDA:RGD P protein homotetramerization
GO:0008033 IEA:UniProtKB-KW P tRNA processing

KEGG Pathway Links

KEGG Pathway ID Description
ko05010 Alzheimer's disease
rno05010 Alzheimer's disease
rno01100 Metabolic pathways
ko00280 Valine, leucine and isoleucine degradation
rno00280 Valine, leucine and isoleucine degradation

REACTOME Pathway Links

REACTOME Pathway ID Description
5953282 Branched-chain amino acid catabolism
5953250 Metabolism
5953272 Metabolism of amino acids and derivatives

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
hydroxysteroid (17-beta) dehydrogenase 10
Protein Entry
HCD2_RAT
UniProt ID
O70351
Species
Rat

Comments

Comment Type Description
Catalytic Activity (2S,3S)-3-hydroxy-2-methylbutanoyl-CoA + NAD(+) = 2-methylacetoacetyl-CoA + NADH.
Catalytic Activity (S)-3-hydroxyacyl-CoA + NAD(+) = 3-oxoacyl-CoA + NADH.
Catalytic Activity Testosterone + NAD(P)(+) = androst-4-ene-3,17- dione + NAD(P)H.
Function Functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/TRMT10C, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends. Catalyzes the beta-oxidation at position 17 of androgens and estrogens and has 3-alpha-hydroxysteroid dehydrogenase activity with androsterone. Catalyzes the third step in the beta-oxidation of fatty acids. Carries out oxidative conversions of 7-alpha-OH and 7-beta-OH bile acids. Also exhibits 20-beta-OH and 21-OH dehydrogenase activities with C21 steroids (By similarity)
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family
Subcellular Location Mitochondrion .
Subunit Homotetramer. Interacts with MRPP1/TRMT10C and MRPP3/KIAA0391 (By similarity)

Identical and Related Proteins

Unique RefSeq proteins for LMP012682 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13994225 RefSeq NP_113870 261 3-hydroxyacyl-CoA dehydrogenase type-2

Identical Sequences to LMP012682 proteins

Reference Database Accession Length Protein Name
GI:13994225 GenBank AAF14853.1 261 17beta-hydroxysteroid dehydrogenase type 10/short chain L-3-hydroxyacyl-CoA dehydrogenase [Rattus norvegicus]
GI:13994225 GenBank EDL86310.1 261 hydroxyacyl-Coenzyme A dehydrogenase type II [Rattus norvegicus]
GI:13994225 GenBank AAI58588.1 261 Hydroxysteroid (17-beta) dehydrogenase 10 [Rattus norvegicus]

Related Sequences to LMP012682 proteins

Reference Database Accession Length Protein Name
GI:13994225 GenBank AAF14853.1 261 17beta-hydroxysteroid dehydrogenase type 10/short chain L-3-hydroxyacyl-CoA dehydrogenase [Rattus norvegicus]
GI:13994225 GenBank EDL86310.1 261 hydroxyacyl-Coenzyme A dehydrogenase type II [Rattus norvegicus]
GI:13994225 GenBank AAI58588.1 261 Hydroxysteroid (17-beta) dehydrogenase 10 [Rattus norvegicus]