Gene/Proteome Database (LMPD)
LMPD ID
LMP012682
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 10
Gene Symbol
Synonyms
Hadh2;
Alternate Names
3-hydroxyacyl-CoA dehydrogenase type-2; type II HADH; 17-beta-HSD 10; mitochondrial RNase P protein 2; amyloid beta-peptide binding protein; mitochondrial ribonuclease P protein 2; 17-beta-hydroxysteroid dehydrogenase 10; 3-hydroxyacyl-CoA dehydrogenase type II; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; hydroxyacyl-Coenzyme A dehydrogenase type II; hydroxyacyl-Coenzyme A dehydrogenase, type II; short chain L-3-hydroxyacyl-CoA dehydrogenase; endoplasmic reticulum-associated amyloid beta-peptide-binding protein;
Chromosome
X
Map Location
Xq21
EC Number
1.1.1.35
Summary
a type 10 17beta-hydroxysteroid dehydrogenase enzyme of the mitochondria [RGD, Feb 2006]
Orthologs
Proteins
3-hydroxyacyl-CoA dehydrogenase type-2 | |
---|---|
Refseq ID | NP_113870 |
Protein GI | 13994225 |
UniProt ID | O70351 |
mRNA ID | NM_031682 |
Length | 261 |
MAAACRSVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTTLPDKVRNFLASQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP |
Gene Information
Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 10
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005739 | ISS:UniProtKB | C | mitochondrion |
GO:0047015 | IEA:UniProtKB-EC | F | 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity |
GO:0003857 | IEA:UniProtKB-EC | F | 3-hydroxyacyl-CoA dehydrogenase activity |
GO:0018454 | IDA:RGD | F | acetoacetyl-CoA reductase activity |
GO:0001540 | IDA:RGD | F | beta-amyloid binding |
GO:0004303 | IDA:RGD | F | estradiol 17-beta-dehydrogenase activity |
GO:0030331 | IPI:RGD | F | estrogen receptor binding |
GO:0042802 | IDA:RGD | F | identical protein binding |
GO:0051287 | IDA:RGD | F | NAD binding |
GO:0005496 | IDA:RGD | F | steroid binding |
GO:0030283 | IEA:UniProtKB-EC | F | testosterone dehydrogenase [NAD(P)] activity |
GO:0007569 | IEP:RGD | P | cell aging |
GO:0033327 | IEP:RGD | P | Leydig cell differentiation |
GO:0051289 | IDA:RGD | P | protein homotetramerization |
GO:0008033 | IEA:UniProtKB-KW | P | tRNA processing |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko05010 | Alzheimer's disease |
rno05010 | Alzheimer's disease |
rno01100 | Metabolic pathways |
ko00280 | Valine, leucine and isoleucine degradation |
rno00280 | Valine, leucine and isoleucine degradation |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxysteroid (17-beta) dehydrogenase 10
Protein Entry
HCD2_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Catalytic Activity | (2S,3S)-3-hydroxy-2-methylbutanoyl-CoA + NAD(+) = 2-methylacetoacetyl-CoA + NADH. |
Catalytic Activity | (S)-3-hydroxyacyl-CoA + NAD(+) = 3-oxoacyl-CoA + NADH. |
Catalytic Activity | Testosterone + NAD(P)(+) = androst-4-ene-3,17- dione + NAD(P)H. |
Function | Functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/TRMT10C, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends. Catalyzes the beta-oxidation at position 17 of androgens and estrogens and has 3-alpha-hydroxysteroid dehydrogenase activity with androsterone. Catalyzes the third step in the beta-oxidation of fatty acids. Carries out oxidative conversions of 7-alpha-OH and 7-beta-OH bile acids. Also exhibits 20-beta-OH and 21-OH dehydrogenase activities with C21 steroids (By similarity) |
Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family |
Subcellular Location | Mitochondrion . |
Subunit | Homotetramer. Interacts with MRPP1/TRMT10C and MRPP3/KIAA0391 (By similarity) |
Identical and Related Proteins
Unique RefSeq proteins for LMP012682 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
13994225 | RefSeq | NP_113870 | 261 | 3-hydroxyacyl-CoA dehydrogenase type-2 |
Identical Sequences to LMP012682 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:13994225 | GenBank | AAF14853.1 | 261 | 17beta-hydroxysteroid dehydrogenase type 10/short chain L-3-hydroxyacyl-CoA dehydrogenase [Rattus norvegicus] |
GI:13994225 | GenBank | EDL86310.1 | 261 | hydroxyacyl-Coenzyme A dehydrogenase type II [Rattus norvegicus] |
GI:13994225 | GenBank | AAI58588.1 | 261 | Hydroxysteroid (17-beta) dehydrogenase 10 [Rattus norvegicus] |
Related Sequences to LMP012682 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:13994225 | GenBank | AAF14853.1 | 261 | 17beta-hydroxysteroid dehydrogenase type 10/short chain L-3-hydroxyacyl-CoA dehydrogenase [Rattus norvegicus] |
GI:13994225 | GenBank | EDL86310.1 | 261 | hydroxyacyl-Coenzyme A dehydrogenase type II [Rattus norvegicus] |
GI:13994225 | GenBank | AAI58588.1 | 261 | Hydroxysteroid (17-beta) dehydrogenase 10 [Rattus norvegicus] |