Gene/Proteome Database (LMPD)

LMPD ID
LMP012683
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
alpha 1,4-galactosyltransferase
Gene Symbol
Synonyms
Gb3;
Alternate Names
lactosylceramide 4-alpha-galactosyltransferase; Gb3 synthase; alpha4Gal-T1; globotriaosylceramide synthase; A4galt {ECO:0000312|RGD:621583}; alpha-1,4-galactosyltransferase; alpha-1,4-N-acetylglucosaminyltransferase; UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase;
Chromosome
7
Map Location
7q34
EC Number
2.4.1.228
Summary
transfers a UDP-sugar in an alpha1, 4-linkage to a beta-linked Gal found in mucin [RGD, Feb 2006]
Orthologs

Proteins

lactosylceramide 4-alpha-galactosyltransferase
Refseq ID NP_071576
Protein GI 11560038
UniProt ID Q9JI93
mRNA ID NM_022240
Length 360
MGISRSDLEETMSKPPDCLPRMLRGTPRQRVFTLFIISFKFTFLVSILIYWHTVGAPKDQRRQYSLPVDFPCPQLAFPRVSAPGNIFFLETSDRTNPSFLFMCSVESAARAHPESQVVVLMKGLPRDTTAWPRNLGISLLSCFPNVQIRPLDLQELFEDTPLAAWYLEAQHRWEPYLLPVLSDASRIALLWKFGGIYLDTDFIVLKNLRNLTNMLGIQSRYVLNGAFLAFERKHEFLALCIRDFVAHYNGWIWGHQGPQLLTRVFKKWCSIHSLKESRACRGVTALPPEAFYPIPWQNWKKYFEDVSPEELAQLLNATYAVHVWNKKSQGTHLEATSRALLAQLHARYCPTTHRAMTMYL

Gene Information

Entrez Gene ID
Gene Name
alpha 1,4-galactosyltransferase
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008378 ISS:UniProtKB F galactosyltransferase activity
GO:0050512 IEA:UniProtKB-EC F lactosylceramide 4-alpha-galactosyltransferase activity
GO:0015643 IEA:Ensembl F toxic substance binding
GO:0001576 IEA:Ensembl P globoside biosynthetic process
GO:0007009 IEA:Ensembl P plasma membrane organization
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
ko00603 Glycosphingolipid biosynthesis - globo series
rno00603 Glycosphingolipid biosynthesis - globo series
M00068 Glycosphingolipid biosynthesis, globo-series, LacCer => Gb4Cer
rno01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR007652 Alpha 1,4-glycosyltransferase domain
IPR007577 Glycosyltransferase, DXD sugar-binding motif
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
alpha 1,4-galactosyltransferase
Protein Entry
A4GAT_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity UDP-alpha-D-galactose + beta-D-galactosyl- (1->4)-D-glucosyl-(1<->1)-ceramide = UDP + alpha-D-galactosyl- (1->4)-beta-D-galactosyl-(1->4)-D-glucosyl-(1<->1)-ceramide
Domain The conserved DXD motif is involved in enzyme activity
Function Necessary for the biosynthesis of the Pk antigen of blood histogroup P. Catalyzes the transfer of galactose to lactosylceramide and galactosylceramide. Necessary for the synthesis of the receptor for bacterial verotoxins
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 32 family
Subcellular Location Golgi apparatus membrane ; Single-pass type II membrane protein .
Tissue Specificity Ubiquitous. Highly expressed in kidney, mesenteric lymph node, spleen and brain

Identical and Related Proteins

Unique RefSeq proteins for LMP012683 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
11560038 RefSeq NP_071576 360 lactosylceramide 4-alpha-galactosyltransferase

Identical Sequences to LMP012683 proteins

Reference Database Accession Length Protein Name
GI:11560038 GenBank EDM15635.1 360 alpha 1,4-galactosyltransferase, isoform CRA_a [Rattus norvegicus]
GI:11560038 RefSeq XP_006242179.1 360 PREDICTED: lactosylceramide 4-alpha-galactosyltransferase isoform X1 [Rattus norvegicus]
GI:11560038 RefSeq XP_006242180.1 360 PREDICTED: lactosylceramide 4-alpha-galactosyltransferase isoform X1 [Rattus norvegicus]
GI:11560038 RefSeq XP_006242182.1 360 PREDICTED: lactosylceramide 4-alpha-galactosyltransferase isoform X1 [Rattus norvegicus]

Related Sequences to LMP012683 proteins

Reference Database Accession Length Protein Name
GI:11560038 RefSeq XP_006242179.1 360 PREDICTED: lactosylceramide 4-alpha-galactosyltransferase isoform X1 [Rattus norvegicus]
GI:11560038 RefSeq XP_006242180.1 360 PREDICTED: lactosylceramide 4-alpha-galactosyltransferase isoform X1 [Rattus norvegicus]
GI:11560038 RefSeq XP_006242182.1 360 PREDICTED: lactosylceramide 4-alpha-galactosyltransferase isoform X1 [Rattus norvegicus]