Gene/Proteome Database (LMPD)
LMPD ID
LMP012683
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
alpha 1,4-galactosyltransferase
Gene Symbol
Synonyms
Gb3;
Alternate Names
lactosylceramide 4-alpha-galactosyltransferase; Gb3 synthase; alpha4Gal-T1; globotriaosylceramide synthase; A4galt {ECO:0000312|RGD:621583}; alpha-1,4-galactosyltransferase; alpha-1,4-N-acetylglucosaminyltransferase; UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase;
Chromosome
7
Map Location
7q34
EC Number
2.4.1.228
Summary
transfers a UDP-sugar in an alpha1, 4-linkage to a beta-linked Gal found in mucin [RGD, Feb 2006]
Orthologs
Proteins
lactosylceramide 4-alpha-galactosyltransferase | |
---|---|
Refseq ID | NP_071576 |
Protein GI | 11560038 |
UniProt ID | Q9JI93 |
mRNA ID | NM_022240 |
Length | 360 |
MGISRSDLEETMSKPPDCLPRMLRGTPRQRVFTLFIISFKFTFLVSILIYWHTVGAPKDQRRQYSLPVDFPCPQLAFPRVSAPGNIFFLETSDRTNPSFLFMCSVESAARAHPESQVVVLMKGLPRDTTAWPRNLGISLLSCFPNVQIRPLDLQELFEDTPLAAWYLEAQHRWEPYLLPVLSDASRIALLWKFGGIYLDTDFIVLKNLRNLTNMLGIQSRYVLNGAFLAFERKHEFLALCIRDFVAHYNGWIWGHQGPQLLTRVFKKWCSIHSLKESRACRGVTALPPEAFYPIPWQNWKKYFEDVSPEELAQLLNATYAVHVWNKKSQGTHLEATSRALLAQLHARYCPTTHRAMTMYL |
Gene Information
Entrez Gene ID
Gene Name
alpha 1,4-galactosyltransferase
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0008378 | ISS:UniProtKB | F | galactosyltransferase activity |
GO:0050512 | IEA:UniProtKB-EC | F | lactosylceramide 4-alpha-galactosyltransferase activity |
GO:0015643 | IEA:Ensembl | F | toxic substance binding |
GO:0001576 | IEA:Ensembl | P | globoside biosynthetic process |
GO:0007009 | IEA:Ensembl | P | plasma membrane organization |
GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | UDP-alpha-D-galactose + beta-D-galactosyl- (1->4)-D-glucosyl-(1<->1)-ceramide = UDP + alpha-D-galactosyl- (1->4)-beta-D-galactosyl-(1->4)-D-glucosyl-(1<->1)-ceramide |
Domain | The conserved DXD motif is involved in enzyme activity |
Function | Necessary for the biosynthesis of the Pk antigen of blood histogroup P. Catalyzes the transfer of galactose to lactosylceramide and galactosylceramide. Necessary for the synthesis of the receptor for bacterial verotoxins |
Pathway | Protein modification; protein glycosylation. |
Similarity | Belongs to the glycosyltransferase 32 family |
Subcellular Location | Golgi apparatus membrane ; Single-pass type II membrane protein . |
Tissue Specificity | Ubiquitous. Highly expressed in kidney, mesenteric lymph node, spleen and brain |
Identical and Related Proteins
Unique RefSeq proteins for LMP012683 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
11560038 | RefSeq | NP_071576 | 360 | lactosylceramide 4-alpha-galactosyltransferase |
Identical Sequences to LMP012683 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:11560038 | GenBank | EDM15635.1 | 360 | alpha 1,4-galactosyltransferase, isoform CRA_a [Rattus norvegicus] |
GI:11560038 | RefSeq | XP_006242179.1 | 360 | PREDICTED: lactosylceramide 4-alpha-galactosyltransferase isoform X1 [Rattus norvegicus] |
GI:11560038 | RefSeq | XP_006242180.1 | 360 | PREDICTED: lactosylceramide 4-alpha-galactosyltransferase isoform X1 [Rattus norvegicus] |
GI:11560038 | RefSeq | XP_006242182.1 | 360 | PREDICTED: lactosylceramide 4-alpha-galactosyltransferase isoform X1 [Rattus norvegicus] |
Related Sequences to LMP012683 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:11560038 | RefSeq | XP_006242179.1 | 360 | PREDICTED: lactosylceramide 4-alpha-galactosyltransferase isoform X1 [Rattus norvegicus] |
GI:11560038 | RefSeq | XP_006242180.1 | 360 | PREDICTED: lactosylceramide 4-alpha-galactosyltransferase isoform X1 [Rattus norvegicus] |
GI:11560038 | RefSeq | XP_006242182.1 | 360 | PREDICTED: lactosylceramide 4-alpha-galactosyltransferase isoform X1 [Rattus norvegicus] |