Gene/Proteome Database (LMPD)
LMPD ID
LMP012691
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
platelet-activating factor acetylhydrolase 1b, catalytic subunit 2
Gene Symbol
Alternate Names
platelet-activating factor acetylhydrolase IB subunit beta; PAF-AH alpha 2; PAFAH subunit beta; PAF-AH subunit beta; PAF-AH 30 kDa subunit; PAF acetylhydrolase 30 kDa subunit; platelet-activating factor acetylhydrolase, isoform 1b, subunit 2; platelet-activating factor acetylhydrolase, isoform Ib, subunit 2; platelet-activating factor acetylhydrolase, isoform Ib, beta subunit; platelet-activating factor acetylhydrolase, isoform 1b, alpha2 subunit; platelet-activating factor acetylhydrolase alpha 2 subunit (PAF-AH alpha 2);
Chromosome
8
Map Location
8q22
EC Number
3.1.1.47
Summary
subunit of the brain intracellular platelet-activating factor acetylhydrolase, which is composed of alpha1, alpha2, and beta subunits [RGD, Feb 2006]
Orthologs
Proteins
| platelet-activating factor acetylhydrolase IB subunit beta | |
|---|---|
| Refseq ID | NP_071782 |
| Protein GI | 11693154 |
| UniProt ID | O35264 |
| mRNA ID | NM_022387 |
| Length | 229 |
| MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDIDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA | |
Gene Information
Entrez Gene ID
Gene Name
platelet-activating factor acetylhydrolase 1b, catalytic subunit 2
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | IDA:RGD | C | cytosol |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0005730 | IEA:Ensembl | C | nucleolus |
| GO:0005886 | IEA:Ensembl | C | plasma membrane |
| GO:0003847 | IEA:UniProtKB-EC | F | 1-alkyl-2-acetylglycerophosphocholine esterase activity |
| GO:0047179 | IDA:RGD | F | platelet-activating factor acetyltransferase activity |
| GO:0046982 | IPI:RGD | F | protein heterodimerization activity |
| GO:0042803 | IDA:RGD | F | protein homodimerization activity |
| GO:0007420 | IEP:RGD | P | brain development |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
| GO:0016239 | IEA:Ensembl | P | positive regulation of macroautophagy |
| GO:0007283 | IEA:Ensembl | P | spermatogenesis |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR013831 | SGNH_hydro-type_esterase_dom |
UniProt Annotations
Entry Information
Gene Name
platelet-activating factor acetylhydrolase 1b, catalytic subunit 2
Protein Entry
PA1B2_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 1-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H(2)O = 1-alkyl-sn-glycero-3-phosphocholine + acetate. |
| Function | Inactivates PAF by removing the acetyl group at the sn-2 position. This is a catalytic subunit. |
| Interaction | P43033:PAFAH1B1 (xeno); NbExp=2; IntAct=EBI-915500, EBI-1007886; |
| Similarity | Belongs to the 'GDSL' lipolytic enzyme family. Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily |
| Similarity | Belongs to the 'GDSL' lipolytic enzyme family. Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily. {ECO:0000305}. |
| Subcellular Location | Cytoplasm . |
| Subcellular Location | Cytoplasm {ECO:0000250}. |
| Subunit | Cytosolic PAF-AH IB is formed of three subunits of 45 kDa (alpha), 30 kDa (beta) and 29 kDa (gamma). The catalytic activity of the enzyme resides in the beta and gamma subunits, whereas the alpha subunit has regulatory activity. Trimer formation is not essential for the catalytic activity. |
| Tissue Specificity | Expressed in heart, brain, spleen, lung, liver, kidney and testis. Not expressed in skeletal muscle. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012691 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 11693154 | RefSeq | NP_071782 | 229 | platelet-activating factor acetylhydrolase IB subunit beta |
Identical Sequences to LMP012691 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:11693154 | RefSeq | XP_006243020.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Rattus norvegicus] |
| GI:11693154 | RefSeq | XP_006510147.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X4 [Mus musculus] |
| GI:11693154 | RefSeq | XP_006510148.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X5 [Mus musculus] |
| GI:11693154 | RefSeq | XP_008764394.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Rattus norvegicus] |
Related Sequences to LMP012691 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:11693154 | GenBank | EDL95390.1 | 229 | platelet-activating factor acetylhydrolase, isoform 1b, alpha2 subunit, isoform CRA_a [Rattus norvegicus] |
| GI:11693154 | GenBank | EDL95391.1 | 229 | platelet-activating factor acetylhydrolase, isoform 1b, alpha2 subunit, isoform CRA_a [Rattus norvegicus] |
| GI:11693154 | RefSeq | XP_008764394.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Rattus norvegicus] |