LIPID MAPS

LMPD ID

LMP012693

Gene ID

64194

Species

Rattus norvegicus (Rat)

Gene Name

insulin induced gene 1

Gene Symbol

Insig1

Alternate Names

insulin-induced gene 1 protein; INSIG-1; immediate-early protein CL-6; growth response protein (CL-6); insulin-induced growth response protein CL-6;

Chromosome

4

Map Location

4q11

Summary

insulin-induced growth response gene; may play a role in regulating intracellular cholesterol concentrations [RGD, Feb 2006]

Orthologs

View orthologs and multiple alignments for Insig1

insulin-induced gene 1 protein
Refseq ID	NP_071787
Protein GI	11693162
UniProt ID	Q08755
mRNA ID	NM_022392
Length	259
MPRLHDHVWSYPSAGAARPYSLPRGMIAAALCPQGPGAPEPEPAPRGQREGTAGFSARPGSWHHDLVQRSLVLFSFGVVLALVLNLLQIQRNVTLFPDEVIATIFSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD

Entrez Gene ID

64194

Gene Name

insulin induced gene 1

Gene Symbol

Insig1

Species

Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID	Source	Type	Description
GO:0005783	IEA:UniProtKB-KW	C	endoplasmic reticulum
GO:0016021	IEA:UniProtKB-KW	C	integral component of membrane
GO:0032869	IEP:RGD	P	cellular response to insulin stimulus
GO:0008203	IEA:UniProtKB-KW	P	cholesterol metabolic process
GO:0032355	IEP:RGD	P	response to estradiol
GO:0070542	IEP:RGD	P	response to fatty acid
GO:0033993	IEP:RGD	P	response to lipid
GO:0043434	IEP:RGD	P	response to peptide hormone

REACTOME Pathway Links

REACTOME Pathway ID	Description
5953250	Metabolism
5953289	Metabolism of lipids and lipoproteins
5954497	Regulation of cholesterol biosynthesis by SREBP (SREBF)

InterPro Annotations

Accession	Description
IPR009904	Insulin-induced gene 1 protein
IPR025929	Insulin-induced protein family

Entry Information

Gene Name

insulin induced gene 1

Protein Entry

INSI1_RAT

UniProt ID

Q08755

Species

Rat

Comments

Comment Type	Description
Function	Mediates feedback control of cholesterol synthesis by controlling SCAP and HMGCR. Functions by blocking the processing of sterol regulatory element-binding proteins (SREBPs). Capable of retaining the SCAP-SREBF2 complex in the ER thus preventing it from escorting SREBPs to the Golgi. Initiates the sterol-mediated ubiquitin-mediated endoplasmic reticulum-associated degradation (ERAD) of HMGCR via recruitment of the reductase to the ubiquitin ligase, AMFR/gp78. May play a role in growth and differentiation of tissues involved in metabolic control. May play a regulatory role during G0/G1 transition of cell growth (By similarity)
Induction	By insulin and hepatectomy.
Ptm	Ubiquitinated. Subsequent to sterol deprivation, the SCAP- SREBF2 complex becomes dissociated from INSIG1, is then ubiquitinated and degraded in proteasomes. Although ubiquitination is required for rapid INSIG1 degradation, it is not required for release of the SCAP-SREBP complex. Ubiquitinated by RNF139 (By similarity)
Similarity	Belongs to the INSIG family
Subcellular Location	Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein .
Subunit	Binds to the SCAP-SREBF2 complex only in the presence of sterols. Interacts with RNF139. Interacts with HMGCR (via its SSD); the interaction, accelerated by sterols, leads to the recruitment of HMGCR to AMFR/gp78 for its ubiquitination by the sterol-mediated ERAD pathway. Interacts with AMFR/gp78 (via its membrane domain); the interaction recruits HMCR at the ER membrane for its ubiquitination and degradation by the sterol-mediated ERAD pathway (By similarity)
Tissue Specificity	Highly expressed in liver and kidney.

Unique RefSeq proteins for LMP012693 (as displayed in Record Overview)

Protein GI	Database	Accession	Length	Protein Name
11693162	RefSeq	NP_071787	259	insulin-induced gene 1 protein

Identical Sequences to LMP012693 proteins

Reference	Database	Accession	Length	Protein Name
GI:11693162	GenBank	AAA40938.1	259	growth response protein [Rattus norvegicus]
GI:11693162	GenBank	AAH78827.1	259	Insulin induced gene 1 [Rattus norvegicus]
GI:11693162	GenBank	EDL86413.1	259	insulin induced gene 1 [Rattus norvegicus]
GI:11693162	SwissProt	Q08755.1	259	RecName: Full=Insulin-induced gene 1 protein; Short=INSIG-1; AltName: Full=Immediate-early protein CL-6; AltName: Full=Insulin-induced growth response protein CL-6 [Rattus norvegicus]

Related Sequences to LMP012693 proteins

Reference	Database	Accession	Length	Protein Name
GI:11693162	GenBank	AAA40938.1	259	growth response protein [Rattus norvegicus]
GI:11693162	GenBank	EDL86413.1	259	insulin induced gene 1 [Rattus norvegicus]
GI:11693162	SwissProt	Q08755.1	259	RecName: Full=Insulin-induced gene 1 protein; Short=INSIG-1; AltName: Full=Immediate-early protein CL-6; AltName: Full=Insulin-induced growth response protein CL-6 [Rattus norvegicus]