Gene/Proteome Database (LMPD)

LMPD ID
LMP012696
Gene ID
64317
Species
Rattus norvegicus (Rat)
Gene Name
glutathione peroxidase 3
Gene Symbol
Gpx3
Synonyms
Gpxp; GPx-3; GPx-P; GSHPx-3; GSHPx-P;
Alternate Names
glutathione peroxidase 3; plasma glutathione peroxidase;
Chromosome
10
Map Location
10q22
EC Number
1.11.1.9
Summary
This gene product belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. The active site of this enzyme contains a selenocysteine residue, which is encoded by UGA that normally signals translation termination. This gene is highly expressed in the kidney where it may play a role in protecting the kidney from oxidative damage. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for Gpx3

Proteins

glutathione peroxidase 3 precursor
Refseq ID NP_071970
Protein GI 41053837
UniProt ID P23764
mRNA ID NM_022525
Length 226
MARILRASCLLSLLLAGFVPPGRGQEKSKTDCHGGMSGTIYEYGALTIDGEEYIPFKQYAGKYILFVNVASYUGLTDQYLELNALQEELGPFGLVILGFPCNQFGKQEPGENSEILPSLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKIHDIRWNFEKFLVGPDGIPIMRWYHRTTVSNVKMDILSYMRRQAALGARGK
sig_peptide: 1..24 inference: non-experimental evidence, no additional details recorded note: Potential; propagated from UniProtKB/Swiss-Prot (P23764.2) calculated_mol_wt: 2512 peptide sequence: MARILRASCLLSLLLAGFVPPGRG sig_peptide: 1..19 calculated_mol_wt: 2048 peptide sequence: MARILRASCLLSLLLAGFV mat_peptide: 20..226 product: glutathione peroxidase 3 calculated_mol_wt: 23395 peptide sequence: PPGRGQEKSKTDCHGGMSGTIYEYGALTIDGEEYIPFKQYAGKYILFVNVASYUGLTDQYLELNALQEELGPFGLVILGFPCNQFGKQEPGENSEILPSLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKIHDIRWNFEKFLVGPDGIPIMRWYHRTTVSNVKMDILSYMRRQAALGARGK mat_peptide: 25..226 product: Glutathione peroxidase 3 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P23764.2) calculated_mol_wt: 22930 peptide sequence: QEKSKTDCHGGMSGTIYEYGALTIDGEEYIPFKQYAGKYILFVNVASYUGLTDQYLELNALQEELGPFGLVILGFPCNQFGKQEPGENSEILPSLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKIHDIRWNFEKFLVGPDGIPIMRWYHRTTVSNVKMDILSYMRRQAALGARGK

Gene Information

Entrez Gene ID
64317
Gene Name
glutathione peroxidase 3
Gene Symbol
Gpx3
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005615 ISS:UniProtKB C extracellular space
GO:0043295 IDA:RGD F glutathione binding
GO:0004602 ISS:UniProtKB F glutathione peroxidase activity
GO:0008430 ISS:UniProtKB F selenium binding
GO:0007565 IEP:RGD P female pregnancy
GO:0006749 IDA:RGD P glutathione metabolic process
GO:0042744 IDA:RGD P hydrogen peroxide catabolic process
GO:0051289 ISS:UniProtKB P protein homotetramerization
GO:0051412 IEP:RGD P response to corticosterone
GO:0042493 IEP:RGD P response to drug
GO:0002238 IEP:RGD P response to molecule of fungal origin
GO:0014070 IEP:RGD P response to organic cyclic compound
GO:0010033 IEP:RGD P response to organic substance
GO:0010269 IEP:RGD P response to selenium ion

KEGG Pathway Links

KEGG Pathway ID Description
ko00590 Arachidonic acid metabolism
rno00590 Arachidonic acid metabolism
ko00480 Glutathione metabolism
rno00480 Glutathione metabolism
ko04918 Thyroid hormone synthesis
rno04918 Thyroid hormone synthesis

Domain Information

InterPro Annotations

Accession Description
IPR000889 Glutathione peroxidase
IPR029759 Glutathione peroxidase active site
IPR029760 Glutathione peroxidase conserved site
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
glutathione peroxidase 3
Protein Entry
GPX3_RAT
UniProt ID
P23764
Species
Rat

Comments

Comment Type Description
Catalytic Activity 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.
Function Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.
Similarity Belongs to the glutathione peroxidase family
Subcellular Location Secreted.
Subunit Homotetramer.
Tissue Specificity Secreted in plasma.

Identical and Related Proteins

Unique RefSeq proteins for LMP012696 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
41053837 RefSeq NP_071970 226 glutathione peroxidase 3 precursor

Identical Sequences to LMP012696 proteins

Reference Database Accession Length Protein Name
GI:41053837 GenBank AAH62227.1 226 Glutathione peroxidase 3 [Rattus norvegicus]
GI:41053837 SwissProt P23764.2 226 RecName: Full=Glutathione peroxidase 3; Short=GPx-3; Short=GSHPx-3; AltName: Full=Plasma glutathione peroxidase; Short=GPx-P; Short=GSHPx-P; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP012696 proteins

Reference Database Accession Length Protein Name
GI:41053837 DBBJ BAA00587.2 226 plasma glutathione peroxidase precursor [Rattus norvegicus]
GI:41053837 GenBank AAH62227.1 226 Glutathione peroxidase 3 [Rattus norvegicus]
GI:41053837 SwissProt P23764.2 226 RecName: Full=Glutathione peroxidase 3; Short=GPx-3; Short=GSHPx-3; AltName: Full=Plasma glutathione peroxidase; Short=GPx-P; Short=GSHPx-P; Flags: Precursor [Rattus norvegicus]