Gene/Proteome Database (LMPD)

LMPD ID
LMP012710
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
endothelial cell-specific molecule 1
Gene Symbol
Synonyms
Pg25;
Alternate Names
endothelial cell-specific molecule 1; ESM-1 secretory protein; pineal specific PG25 protein;
Chromosome
2
Map Location
2q14
Summary
secreted protein mainly expressed in endothelial cells; may be involved in lung-kidney interaction [RGD, Feb 2006]
Orthologs

Proteins

endothelial cell-specific molecule 1 precursor
Refseq ID NP_072126
Protein GI 12018274
UniProt ID P97682
mRNA ID NM_022604
Length 184
MKSLLLLTTLLIPLHLGMAWSAKYAVDCPEHCDNTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGVCKDCPYGTFGMDCKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASQTERDAASGDGNAVREEIGDRNAARPSVMKWLNPR
sig_peptide: 1..21 inference: non-experimental evidence, no additional details recorded note: Potential; propagated from UniProtKB/Swiss-Prot (P97682.1) calculated_mol_wt: 2352 peptide sequence: MKSLLLLTTLLIPLHLGMAWS mat_peptide: 22..184 product: Endothelial cell-specific molecule 1 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P97682.1) calculated_mol_wt: 17741 peptide sequence: AKYAVDCPEHCDNTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGVCKDCPYGTFGMDCKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASQTERDAASGDGNAVREEIGDRNAARPSVMKWLNPR

Gene Information

Entrez Gene ID
Gene Name
endothelial cell-specific molecule 1
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0008284 IEA:Ensembl P positive regulation of cell proliferation
GO:1902204 IEA:Ensembl P positive regulation of hepatocyte growth factor receptor signaling pathway
GO:0001558 IEA:InterPro P regulation of cell growth
GO:0002040 IEA:Ensembl P sprouting angiogenesis

Domain Information

InterPro Annotations

Accession Description
IPR000867 IGFBP-like
IPR009030 Insulin-like growth factor binding protein, N-terminal

UniProt Annotations

Entry Information

Gene Name
endothelial cell-specific molecule 1
Protein Entry
ESM1_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Function Involved in angiogenesis; promotes angiogenic sprouting. May have potent implications in lung endothelial cell-leukocyte interactions (By similarity)
Ptm O-glycosylated; contains chondroitin sulfate and dermatan sulfate
Similarity Contains 1 IGFBP N-terminal domain
Subcellular Location Secreted .
Tissue Specificity Pineal gland specific.

Identical and Related Proteins

Unique RefSeq proteins for LMP012710 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
12018274 RefSeq NP_072126 184 endothelial cell-specific molecule 1 precursor

Identical Sequences to LMP012710 proteins

Reference Database Accession Length Protein Name
GI:12018274 GenBank AAB39192.1 184 PG25 [Rattus norvegicus]
GI:12018274 GenBank AAH70888.1 184 Endothelial cell-specific molecule 1 [Rattus norvegicus]
GI:12018274 GenBank EDM10370.1 184 endothelial cell-specific molecule 1 [Rattus norvegicus]
GI:12018274 SwissProt P97682.1 184 RecName: Full=Endothelial cell-specific molecule 1; Short=ESM-1; AltName: Full=PG25; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP012710 proteins

Reference Database Accession Length Protein Name
GI:12018274 GenBank AAB39192.1 184 PG25 [Rattus norvegicus]
GI:12018274 GenBank EDM10370.1 184 endothelial cell-specific molecule 1 [Rattus norvegicus]
GI:12018274 SwissProt P97682.1 184 RecName: Full=Endothelial cell-specific molecule 1; Short=ESM-1; AltName: Full=PG25; Flags: Precursor [Rattus norvegicus]