Gene/Proteome Database (LMPD)
LMPD ID
LMP012710
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
endothelial cell-specific molecule 1
Gene Symbol
Synonyms
Pg25;
Alternate Names
endothelial cell-specific molecule 1; ESM-1 secretory protein; pineal specific PG25 protein;
Chromosome
2
Map Location
2q14
Summary
secreted protein mainly expressed in endothelial cells; may be involved in lung-kidney interaction [RGD, Feb 2006]
Orthologs
Proteins
| endothelial cell-specific molecule 1 precursor | |
|---|---|
| Refseq ID | NP_072126 |
| Protein GI | 12018274 |
| UniProt ID | P97682 |
| mRNA ID | NM_022604 |
| Length | 184 |
| MKSLLLLTTLLIPLHLGMAWSAKYAVDCPEHCDNTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGVCKDCPYGTFGMDCKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASQTERDAASGDGNAVREEIGDRNAARPSVMKWLNPR | |
| sig_peptide: 1..21 inference: non-experimental evidence, no additional details recorded note: Potential; propagated from UniProtKB/Swiss-Prot (P97682.1) calculated_mol_wt: 2352 peptide sequence: MKSLLLLTTLLIPLHLGMAWS mat_peptide: 22..184 product: Endothelial cell-specific molecule 1 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P97682.1) calculated_mol_wt: 17741 peptide sequence: AKYAVDCPEHCDNTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGVCKDCPYGTFGMDCKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASQTERDAASGDGNAVREEIGDRNAARPSVMKWLNPR | |
Gene Information
Entrez Gene ID
Gene Name
endothelial cell-specific molecule 1
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0008284 | IEA:Ensembl | P | positive regulation of cell proliferation |
| GO:1902204 | IEA:Ensembl | P | positive regulation of hepatocyte growth factor receptor signaling pathway |
| GO:0001558 | IEA:InterPro | P | regulation of cell growth |
| GO:0002040 | IEA:Ensembl | P | sprouting angiogenesis |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Involved in angiogenesis; promotes angiogenic sprouting. May have potent implications in lung endothelial cell-leukocyte interactions (By similarity) |
| Ptm | O-glycosylated; contains chondroitin sulfate and dermatan sulfate |
| Similarity | Contains 1 IGFBP N-terminal domain |
| Subcellular Location | Secreted . |
| Tissue Specificity | Pineal gland specific. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012710 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 12018274 | RefSeq | NP_072126 | 184 | endothelial cell-specific molecule 1 precursor |
Identical Sequences to LMP012710 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:12018274 | GenBank | AAB39192.1 | 184 | PG25 [Rattus norvegicus] |
| GI:12018274 | GenBank | AAH70888.1 | 184 | Endothelial cell-specific molecule 1 [Rattus norvegicus] |
| GI:12018274 | GenBank | EDM10370.1 | 184 | endothelial cell-specific molecule 1 [Rattus norvegicus] |
| GI:12018274 | SwissProt | P97682.1 | 184 | RecName: Full=Endothelial cell-specific molecule 1; Short=ESM-1; AltName: Full=PG25; Flags: Precursor [Rattus norvegicus] |
Related Sequences to LMP012710 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:12018274 | GenBank | AAB39192.1 | 184 | PG25 [Rattus norvegicus] |
| GI:12018274 | GenBank | EDM10370.1 | 184 | endothelial cell-specific molecule 1 [Rattus norvegicus] |
| GI:12018274 | SwissProt | P97682.1 | 184 | RecName: Full=Endothelial cell-specific molecule 1; Short=ESM-1; AltName: Full=PG25; Flags: Precursor [Rattus norvegicus] |