Gene/Proteome Database (LMPD)
LMPD ID
LMP012711
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Gene Symbol
Alternate Names
5'-AMP-activated protein kinase subunit beta-2; AMPK beta-2 chain; AMPK subunit beta-2; AMP-activated protein kinase beta-2 regulatory subunit;
Chromosome
2
Map Location
2q34
Summary
a component of the AMPK alpha2beta2gamma1 complex which phosphorylates glycogen synthase [RGD, Feb 2006]
Orthologs
Proteins
5'-AMP-activated protein kinase subunit beta-2 | |
---|---|
Refseq ID | NP_072149 |
Protein GI | 12018316 |
UniProt ID | Q9QZH4 |
mRNA ID | NM_022627 |
Length | 271 |
MGNTTSERVSGERHGAKAARAEGGGHGPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVPWQQDLDDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSTKDSVMVLSATHRYKKKYVTTLLYKPI |
Gene Information
Entrez Gene ID
Gene Name
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0031588 | IDA:RGD | C | AMP-activated protein kinase complex |
GO:0016324 | IDA:UniProtKB | C | apical plasma membrane |
GO:0005952 | IDA:RGD | C | cAMP-dependent protein kinase complex |
GO:0005737 | IDA:UniProtKB | C | cytoplasm |
GO:0005654 | TAS:Reactome | C | nucleoplasm |
GO:0019901 | IPI:RGD | F | protein kinase binding |
GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
GO:0006468 | ISS:GOC | P | protein phosphorylation |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko04920 | Adipocytokine signaling pathway |
rno04920 | Adipocytokine signaling pathway |
ko04152 | AMPK signaling pathway |
rno04152 | AMPK signaling pathway |
ko04710 | Circadian rhythm |
rno04710 | Circadian rhythm |
rno04068 | FoxO signaling pathway |
ko05410 | Hypertrophic cardiomyopathy (HCM) |
rno05410 | Hypertrophic cardiomyopathy (HCM) |
ko04910 | Insulin signaling pathway |
rno04910 | Insulin signaling pathway |
ko04932 | Non-alcoholic fatty liver disease (NAFLD) |
rno04932 | Non-alcoholic fatty liver disease (NAFLD) |
ko04921 | Oxytocin signaling pathway |
rno04921 | Oxytocin signaling pathway |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5954481 | Activation of PPARGC1A (PGC-1alpha) by phosphorylation |
5953759 | AMPK inhibits chREBP transcriptional activation activity |
5954019 | Energy dependent regulation of mTOR by LKB1-AMPK |
5953288 | Fatty acid, triacylglycerol, and ketone body metabolism |
5953430 | IGF1R signaling cascade |
5953467 | Import of palmitoyl-CoA into the mitochondrial matrix |
5953422 | Insulin receptor signalling cascade |
5953611 | Integration of energy metabolism |
5953428 | IRS-mediated signalling |
5953425 | IRS-related events |
5953429 | IRS-related events triggered by IGF1R |
5953916 | Membrane Trafficking |
5953250 | Metabolism |
5953289 | Metabolism of lipids and lipoproteins |
5953600 | Mitochondrial biogenesis |
5953766 | mTOR signalling |
5953601 | Organelle biogenesis and maintenance |
5953432 | PI3K Cascade |
5953733 | PKB-mediated events |
5954018 | Regulation of AMPK activity via LKB1 |
5954161 | Regulation of Rheb GTPase activity by AMPK |
5953423 | Signaling by Insulin receptor |
5953431 | Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R) |
5953381 | Signal Transduction |
5954455 | Translocation of GLUT4 to the plasma membrane |
Domain Information
UniProt Annotations
Entry Information
Gene Name
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Protein Entry
AAKB2_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Function | Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3) (By similarity) |
Ptm | Phosphorylated when associated with the catalytic subunit (PRKAA1 or PRKAA2). Phosphorylated by ULK1 and ULK2; leading to negatively regulate AMPK activity and suggesting the existence of a regulatory feedback loop between ULK1, ULK2 and AMPK |
Similarity | Belongs to the 5'-AMP-activated protein kinase beta subunit family |
Subunit | AMPK is a heterotrimer of an alpha catalytic subunit (PRKAA1 or PRKAA2), a beta (PRKAB1 or PRKAB2) and a gamma non- catalytic subunits (PRKAG1, PRKAG2 or PRKAG3) |
Identical and Related Proteins
Unique RefSeq proteins for LMP012711 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
12018316 | RefSeq | NP_072149 | 271 | 5'-AMP-activated protein kinase subunit beta-2 |
Identical Sequences to LMP012711 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:12018316 | GenBank | AAF01293.1 | 271 | AMP-activated protein kinase beta-2 regulatory subunit [Rattus norvegicus] |
GI:12018316 | SwissProt | Q9QZH4.1 | 271 | RecName: Full=5'-AMP-activated protein kinase subunit beta-2; Short=AMPK subunit beta-2 [Rattus norvegicus] |
Related Sequences to LMP012711 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:12018316 | GenBank | AAF01293.1 | 271 | AMP-activated protein kinase beta-2 regulatory subunit [Rattus norvegicus] |
GI:12018316 | RefSeq | XP_006233073.1 | 271 | PREDICTED: 5'-AMP-activated protein kinase subunit beta-2 isoform X1 [Rattus norvegicus] |
GI:12018316 | SwissProt | Q9QZH4.1 | 271 | RecName: Full=5'-AMP-activated protein kinase subunit beta-2; Short=AMPK subunit beta-2 [Rattus norvegicus] |