Gene/Proteome Database (LMPD)

LMPD ID
LMP012711
Gene ID
64562
Species
Rattus norvegicus (Rat)
Gene Name
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Gene Symbol
Prkab2
Alternate Names
5'-AMP-activated protein kinase subunit beta-2; AMPK beta-2 chain; AMPK subunit beta-2; AMP-activated protein kinase beta-2 regulatory subunit;
Chromosome
2
Map Location
2q34
Summary
a component of the AMPK alpha2beta2gamma1 complex which phosphorylates glycogen synthase [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Prkab2

Proteins

5'-AMP-activated protein kinase subunit beta-2
Refseq ID NP_072149
Protein GI 12018316
UniProt ID Q9QZH4
mRNA ID NM_022627
Length 271
MGNTTSERVSGERHGAKAARAEGGGHGPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVPWQQDLDDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSTKDSVMVLSATHRYKKKYVTTLLYKPI

Gene Information

Entrez Gene ID
64562
Gene Name
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Gene Symbol
Prkab2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031588 IDA:RGD C AMP-activated protein kinase complex
GO:0016324 IDA:UniProtKB C apical plasma membrane
GO:0005952 IDA:RGD C cAMP-dependent protein kinase complex
GO:0005737 IDA:UniProtKB C cytoplasm
GO:0005654 TAS:Reactome C nucleoplasm
GO:0019901 IPI:RGD F protein kinase binding
GO:0006633 IEA:UniProtKB-KW P fatty acid biosynthetic process
GO:0006468 ISS:GOC P protein phosphorylation

KEGG Pathway Links

KEGG Pathway ID Description
ko04152 AMPK signaling pathway
rno04152 AMPK signaling pathway
ko04920 Adipocytokine signaling pathway
rno04920 Adipocytokine signaling pathway
ko04710 Circadian rhythm
rno04710 Circadian rhythm
rno04068 FoxO signaling pathway
ko05410 Hypertrophic cardiomyopathy (HCM)
rno05410 Hypertrophic cardiomyopathy (HCM)
ko04910 Insulin signaling pathway
rno04910 Insulin signaling pathway
ko04932 Non-alcoholic fatty liver disease (NAFLD)
rno04932 Non-alcoholic fatty liver disease (NAFLD)
ko04921 Oxytocin signaling pathway
rno04921 Oxytocin signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5953759 AMPK inhibits chREBP transcriptional activation activity
5954481 Activation of PPARGC1A (PGC-1alpha) by phosphorylation
5954019 Energy dependent regulation of mTOR by LKB1-AMPK
5953288 Fatty acid, triacylglycerol, and ketone body metabolism
5953430 IGF1R signaling cascade
5953428 IRS-mediated signalling
5953425 IRS-related events
5953429 IRS-related events triggered by IGF1R
5953467 Import of palmitoyl-CoA into the mitochondrial matrix
5953422 Insulin receptor signalling cascade
5953611 Integration of energy metabolism
5953916 Membrane Trafficking
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953600 Mitochondrial biogenesis
5953601 Organelle biogenesis and maintenance
5953432 PI3K Cascade
5953733 PKB-mediated events
5954018 Regulation of AMPK activity via LKB1
5954161 Regulation of Rheb GTPase activity by AMPK
5953381 Signal Transduction
5953423 Signaling by Insulin receptor
5953431 Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R)
5954455 Translocation of GLUT4 to the plasma membrane
5953766 mTOR signalling

Domain Information

InterPro Annotations

Accession Description
IPR006828 Association with the SNF1 complex (ASC) domain
IPR014756 Immunoglobulin E-set

UniProt Annotations

Entry Information

Gene Name
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Protein Entry
AAKB2_RAT
UniProt ID
Q9QZH4
Species
Rat

Comments

Comment Type Description
Function Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3) (By similarity)
Ptm Phosphorylated when associated with the catalytic subunit (PRKAA1 or PRKAA2). Phosphorylated by ULK1 and ULK2; leading to negatively regulate AMPK activity and suggesting the existence of a regulatory feedback loop between ULK1, ULK2 and AMPK
Similarity Belongs to the 5'-AMP-activated protein kinase beta subunit family
Subunit AMPK is a heterotrimer of an alpha catalytic subunit (PRKAA1 or PRKAA2), a beta (PRKAB1 or PRKAB2) and a gamma non- catalytic subunits (PRKAG1, PRKAG2 or PRKAG3)

Identical and Related Proteins

Unique RefSeq proteins for LMP012711 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
12018316 RefSeq NP_072149 271 5'-AMP-activated protein kinase subunit beta-2

Identical Sequences to LMP012711 proteins

Reference Database Accession Length Protein Name
GI:12018316 GenBank AAF01293.1 271 AMP-activated protein kinase beta-2 regulatory subunit [Rattus norvegicus]
GI:12018316 SwissProt Q9QZH4.1 271 RecName: Full=5'-AMP-activated protein kinase subunit beta-2; Short=AMPK subunit beta-2 [Rattus norvegicus]

Related Sequences to LMP012711 proteins

Reference Database Accession Length Protein Name
GI:12018316 GenBank AAF01293.1 271 AMP-activated protein kinase beta-2 regulatory subunit [Rattus norvegicus]
GI:12018316 RefSeq XP_006233073.1 271 PREDICTED: 5'-AMP-activated protein kinase subunit beta-2 isoform X1 [Rattus norvegicus]
GI:12018316 SwissProt Q9QZH4.1 271 RecName: Full=5'-AMP-activated protein kinase subunit beta-2; Short=AMPK subunit beta-2 [Rattus norvegicus]