Gene/Proteome Database (LMPD)

LMPD ID
LMP012716
Gene ID
64677
Species
Rattus norvegicus (Rat)
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Gene Symbol
Srd5a2
Synonyms
S5AR 2;
Alternate Names
3-oxo-5-alpha-steroid 4-dehydrogenase 2; SR type 2; 5 alpha-SR2; steroid 5-alpha-reductase 2;
Chromosome
6
Map Location
6q13
EC Number
1.3.1.22
Summary
enzyme which converts testosterone to dihydrotestosterone (DHT); also acts on progesterone and corticosterone; plays a central role in sexual differentiation and androgen physiology [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Srd5a2

Proteins

3-oxo-5-alpha-steroid 4-dehydrogenase 2
Refseq ID NP_073202
Protein GI 12083683
UniProt ID P31214
mRNA ID NM_022711
Length 254
MQIVCHQVPVLAGSATLATMGTLILCLGKPASYGKHTESVSSGVPFLPARIAWFLQELPSFVVSVGMLAWQPRSLFGPPGNVLLALFSAHYFHRTFIYSLLTRGRPFPAVLFLRATAFCIGNGLLQAYYLVYCAEYPEEWYTDVRFSFGVFLFILGMGINIHSDYTLRQLRKPGEVIYRIPRGGLFTYVSGANFLGEIIEWIGYALATWSVPAFAFAFFTLCFLGMQAFYHHRFYLKMFKDYPKSRKALIPFIF

Gene Information

Entrez Gene ID
64677
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Gene Symbol
Srd5a2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070852 IDA:RGD C cell body fiber
GO:0005737 IDA:RGD C cytoplasm
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0043025 IDA:RGD C neuronal cell body
GO:0003865 IDA:RGD F 3-oxo-5-alpha-steroid 4-dehydrogenase activity
GO:0033218 IPI:RGD F amide binding
GO:0047751 IEA:UniProtKB-EC F cholestenone 5-alpha-reductase activity
GO:0006702 IDA:RGD P androgen biosynthetic process
GO:0008209 IDA:RGD P androgen metabolic process
GO:0018879 IEP:RGD P biphenyl metabolic process
GO:0060348 IEP:RGD P bone development
GO:0030154 IEA:UniProtKB-KW P cell differentiation
GO:0018894 IEP:RGD P dibenzo-p-dioxin metabolic process
GO:0030540 IEP:RGD P female genitalia development
GO:0021766 IEP:RGD P hippocampus development
GO:0021854 IEP:RGD P hypothalamus development
GO:0030539 IEP:RGD P male genitalia development
GO:0008584 IEP:RGD P male gonad development
GO:0018963 IEP:RGD P phthalate metabolic process
GO:0042493 IEP:RGD P response to drug
GO:0032354 IEP:RGD P response to follicle-stimulating hormone
GO:0031667 IEP:RGD P response to nutrient levels
GO:0014070 IEP:RGD P response to organic cyclic compound
GO:0010033 IDA:RGD P response to organic substance
GO:0043434 IDA:RGD P response to peptide hormone
GO:0048545 IEP:RGD P response to steroid hormone
GO:0033574 IEP:RGD P response to testosterone
GO:0007548 TAS:RGD P sex differentiation
GO:0006694 IDA:RGD P steroid biosynthetic process
GO:0006706 IDA:RGD P steroid catabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko05215 Prostate cancer
rno05215 Prostate cancer
ko00140 Steroid hormone biosynthesis
rno00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR016636 3-oxo-5-alpha-steroid 4-dehydrogenase
IPR001104 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal

UniProt Annotations

Entry Information

Gene Name
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Protein Entry
S5A2_RAT
UniProt ID
P31214
Species
Rat

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=74 nM for testosterone ; KM=42 nM for progesterone ; KM=170 nM for androstenedione ; KM=376 nM for corticosterone ; KM=11.2 uM for cortisol ; Vmax=0.5 nmol/min/mg enzyme ; pH dependence: Optimally active at acidic pHs. ;
Catalytic Activity A 3-oxo-5-alpha-steroid + NADP(+) = a 3-oxo- Delta(4)-steroid + NADPH
Function Converts testosterone (T) into 5-alpha- dihydrotestosterone (DHT) and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology (By similarity)
Similarity Belongs to the steroid 5-alpha reductase family
Subcellular Location Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane ; Multi-pass membrane protein .
Tissue Specificity Expressed in high levels in the prostate and many other androgen-sensitive tissues

Identical and Related Proteins

Unique RefSeq proteins for LMP012716 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
12083683 RefSeq NP_073202 254 3-oxo-5-alpha-steroid 4-dehydrogenase 2

Identical Sequences to LMP012716 proteins

Reference Database Accession Length Protein Name
GI:12083683 GenBank AAA42182.1 254 steroid 5-alpha-reductase 2 [Rattus norvegicus]
GI:12083683 GenBank EDM02850.1 254 steroid 5-alpha-reductase 2 [Rattus norvegicus]
GI:12083683 SwissProt P31214.1 254 RecName: Full=3-oxo-5-alpha-steroid 4-dehydrogenase 2; AltName: Full=5 alpha-SR2; AltName: Full=SR type 2; AltName: Full=Steroid 5-alpha-reductase 2; Short=S5AR 2 [Rattus norvegicus]

Related Sequences to LMP012716 proteins

Reference Database Accession Length Protein Name
GI:12083683 GenBank AAA42182.1 254 steroid 5-alpha-reductase 2 [Rattus norvegicus]
GI:12083683 GenBank EDM02850.1 254 steroid 5-alpha-reductase 2 [Rattus norvegicus]
GI:12083683 SwissProt P31214.1 254 RecName: Full=3-oxo-5-alpha-steroid 4-dehydrogenase 2; AltName: Full=5 alpha-SR2; AltName: Full=SR type 2; AltName: Full=Steroid 5-alpha-reductase 2; Short=S5AR 2 [Rattus norvegicus]