Gene/Proteome Database (LMPD)

LMPD ID
LMP012730
Gene ID
65196
Species
Rattus norvegicus (Rat)
Gene Name
UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 6
Gene Symbol
B4galt6
Alternate Names
beta-1,4-galactosyltransferase 6; b4Gal-T6; beta4Gal-T6; beta-1,4-GalTase 6; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6;
Chromosome
18
Map Location
18p12
EC Number
2.4.1.-
Summary
catalyzes the transfer of galactose from UDP-Gal to glucosylceramide [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for B4galt6

Proteins

beta-1,4-galactosyltransferase 6
Refseq ID NP_113928
Protein GI 13929042
UniProt ID O88419
mRNA ID NM_031740
Length 382
MSALKRMMRVSNRSLIAFIFFFSLSTSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTIGHMIRLYTNKNTTLNGTDYPEGNNTSDYLVQTTTYLPQNFTYSPHLPCPEKLPYMRGFLSVNVSEISFDEVHQLFSKDSEIEPGGHWRPQDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDRAWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYSGYNVTRPEGDLGKYTSIPHHHRGEVQFLGRYKLLRYSKERQFIDGLNNLLYTPKILVDRLYTNISVNLMPELAPVEDY

Gene Information

Entrez Gene ID
65196
Gene Name
UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 6
Gene Symbol
B4galt6
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008489 IDA:RGD F UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0006688 TAS:RGD P glycosphingolipid biosynthetic process
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
M00066 Lactosylceramide biosynthesis
rno01100 Metabolic pathways
ko00600 Sphingolipid metabolism
rno00600 Sphingolipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5953739 Asparagine N-linked glycosylation
5953253 Disease
5953252 Glycogen storage diseases
5953861 Glycosaminoglycan metabolism
5954344 Keratan sulfate biosynthesis
5954345 Keratan sulfate/keratin metabolism
5953870 MPS I - Hurler syndrome
5953869 MPS II - Hunter syndrome
5953872 MPS IIIA - Sanfilippo syndrome A
5953864 MPS IIIB - Sanfilippo syndrome B
5953867 MPS IIIC - Sanfilippo syndrome C
5953871 MPS IIID - Sanfilippo syndrome D
5953866 MPS IV - Morquio syndrome A
5953873 MPS IV - Morquio syndrome B
5953862 MPS IX - Natowicz syndrome
5953865 MPS VI - Maroteaux-Lamy syndrome
5953868 MPS VII - Sly syndrome
5953250 Metabolism
5953249 Metabolism of carbohydrates
5953345 Metabolism of proteins
5953863 Mucopolysaccharidoses
5953251 Myoclonic epilepsy of Lafora
5954395 N-Glycan antennae elongation
5954394 N-glycan antennae elongation in the medial/trans-Golgi
5953728 Post-translational protein modification
5954050 Transport to the Golgi and subsequent modification

Domain Information

InterPro Annotations

Accession Description
IPR003859 Beta-1,4-galactosyltransferase
IPR027791 Galactosyltransferase, C-terminal
IPR027995 Galactosyltransferase, N-terminal
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 6
Protein Entry
B4GT6_RAT
UniProt ID
O88419
Species
Rat

Comments

Comment Type Description
Biophysicochemical Properties pH dependence: Optimum pH is 7.2.;
Catalytic Activity UDP-alpha-D-galactose + beta-D-glucosyl- (1<->1)-ceramide = UDP + beta-D-galactosyl-(1->4)-beta-D-glucosyl- (1<->1)-ceramide
Cofactor Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence= ; Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence= ; Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence= ;
Enzyme Regulation Inhibited by EDTA.
Function Required for the biosynthesis of glycosphingolipids
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 7 family
Subcellular Location Golgi apparatus, Golgi stack membrane {ECO:0000250}; Single-pass type II membrane protein . Note=Trans cisternae of Golgi stack
Tissue Specificity Highest expression in brain with lower levels found in lungs, heart, skeletal muscle and kidney. Lowest expression in testis, liver and spleen

Identical and Related Proteins

Unique RefSeq proteins for LMP012730 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13929042 RefSeq NP_113928 382 beta-1,4-galactosyltransferase 6

Identical Sequences to LMP012730 proteins

Reference Database Accession Length Protein Name
GI:13929042 GenBank AAC24515.1 382 UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase [Rattus norvegicus]
GI:13929042 GenBank EDL76096.1 382 rCG49423, isoform CRA_a [Rattus norvegicus]
GI:13929042 GenBank EDL76097.1 382 rCG49423, isoform CRA_a [Rattus norvegicus]
GI:13929042 SwissProt O88419.1 382 RecName: Full=Beta-1,4-galactosyltransferase 6; Short=Beta-1,4-GalTase 6; Short=Beta4Gal-T6; Short=b4Gal-T6; AltName: Full=UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6; AltName: Full=UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6; Includes: RecName: Full=Glucosylceramide beta-1,4-galactosyltransferase; AltName: Full=Lactosylceramide synthase; Short=LacCer synthase; AltName: Full=UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase [Rattus norvegicus]

Related Sequences to LMP012730 proteins

Reference Database Accession Length Protein Name
GI:13929042 GenBank AAC24515.1 382 UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase [Rattus norvegicus]
GI:13929042 GenBank EDL76097.1 382 rCG49423, isoform CRA_a [Rattus norvegicus]
GI:13929042 SwissProt O88419.1 382 RecName: Full=Beta-1,4-galactosyltransferase 6; Short=Beta-1,4-GalTase 6; Short=Beta4Gal-T6; Short=b4Gal-T6; AltName: Full=UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6; AltName: Full=UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6; Includes: RecName: Full=Glucosylceramide beta-1,4-galactosyltransferase; AltName: Full=Lactosylceramide synthase; Short=LacCer synthase; AltName: Full=UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase [Rattus norvegicus]