Gene/Proteome Database (LMPD)

LMPD ID
LMP012733
Gene ID
65270
Species
Rattus norvegicus (Rat)
Gene Name
globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
Gene Symbol
Gbgt1
Synonyms
Abo; Abol1;
Alternate Names
histo-blood group ABO system transferase 1; NAGAT 1; a transferase; b transferase; cis-AB transferase 1; ABO blood group-like 1; histo-blood group A transferase; histo-blood group B transferase; B blood group galactosyltransferase; blood group A glycosyltransferase 1; transferase B, alpha 1-3-galactosyltransferase); fucosylglycoprotein 3-alpha-galactosyltransferase; N-acetylgalactosaminyltransferase A blood group-like enzyme; fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase; glycoprotein-fucosylgalactoside alpha-galactosyltransferase; ABO blood group (transferase B, alpha 1-3-galactosyltransferase); glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase; ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; ABO blood group (alpha 1-3-N-acetylgalactosaminyltransferase, alpha 1-3-galactosyltransferase); ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase);
Chromosome
3
Map Location
3p13
EC Number
2.4.1.40
Summary
histo-blood group protein with A- and B-transferase activities [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Gbgt1

Proteins

histo-blood group ABO system transferase 1
Refseq ID NP_075582
Protein GI 148747204
UniProt ID Q9ET32
mRNA ID NM_023094
Length 348
MDLRGRPKCYSLHLGILPFIVLVLVFFGYGFLSHKIQEFRNPGGETCMATRQTDVQKVVSVPRMAYPQPNVLTPIRNDVLVFTPWLAPIIWEGTFNIDILNEQFKLQNTTIGLTVFAIKKYVVFLKLFLETAEQHFMVGHKVIYYVFTDRPSDVPQVPLGAGRKLVVLTVRNYTRWQDVSMHRMEMISHFSEQRFQHEVDYLVCGDVDMKFSDHVGVEILSALFGTLHPGFYRSRRESFTYERRPKSQAYIPRDEGDFYYAGGFFGGSVVEVHHLTKACHQAMVEDQANGIEAVWHDESHLNKYLLYHKPTKVLSPEYVWDQKLLGWPSIMKKLRYVAVPKNHQAIRN

Gene Information

Entrez Gene ID
65270
Gene Name
globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
Gene Symbol
Gbgt1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0004381 IEA:UniProtKB-EC F fucosylgalactoside 3-alpha-galactosyltransferase activity
GO:0004380 IDA:RGD F glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0042742 IEP:RGD P defense response to bacterium
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
ko00601 Glycosphingolipid biosynthesis - lacto and neolacto series
rno00601 Glycosphingolipid biosynthesis - lacto and neolacto series
rno01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR005076 Glycosyl transferase, family 6
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
Protein Entry
BGAT1_RAT
UniProt ID
Q9ET32
Species
Rat

Comments

Comment Type Description
Catalytic Activity UDP-N-acetyl-alpha-beta-D-galactosamine + glycoprotein-alpha-L-fucosyl-(1->2)-D-galactose = UDP + glycoprotein-N-acetyl-alpha-D-galactosaminyl-(1->3)-(alpha-L- fucosyl-(1->2))-beta-D-galactose.
Catalytic Activity UDP-alpha-D-galactose + alpha-L-fucosyl- (1->2)-D-galactosyl-R = UDP + alpha-D-galactosyl-(1->3)-(alpha-L- fucosyl-(1->2))-D-galactosyl-R.
Cofactor Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence= ; Note=Binds 1 Mn(2+) ion per subunit. ;
Domain The conserved DXD motif is involved in cofactor binding. The manganese ion interacts with the beta-phosphate group of UDP and may also have a role in catalysis.
Function Posseses strong A transferase activity and a weak B transferase activity
Induction During a Nippostrongylus brasiliensis parasite infection. The expression is a transient event, with a maximum at day 6 of the 13-day-long infection
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 6 family
Subcellular Location Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note=Membrane- bound form in trans cisternae of Golgi. Secreted into the body fluid (By similarity)
Tissue Specificity Tongue, esophagus, large intestine, stomach, caecum, pancreas, uterus, seminal vesicle, submaxillary gland, parotid gland, thyroid gland, parathyroid gland, salivary gland and thymus (at protein level). Esophagus, large intestine, stomach, kidney, urinary bladder, uterus and thymus

Identical and Related Proteins

Unique RefSeq proteins for LMP012733 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
148747204 RefSeq NP_075582 348 histo-blood group ABO system transferase 1

Identical Sequences to LMP012733 proteins

Reference Database Accession Length Protein Name
GI:148747204 GenBank AAF74758.2 348 N-acetylgalactosaminyltransferase A blood group-like enzyme [Rattus norvegicus]
GI:148747204 GenBank AAL82445.1 348 blood group A glycosyltransferase 1 [Rattus norvegicus]
GI:148747204 SwissProt Q9ET32.1 348 RecName: Full=Histo-blood group ABO system transferase 1; AltName: Full=Blood group A glycosyltransferase 1; AltName: Full=Cis-AB transferase 1; AltName: Full=Fucosylglycoprotein 3-alpha-galactosyltransferase; AltName: Full=Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase; AltName: Full=Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase; AltName: Full=Glycoprotein-fucosylgalactoside alpha-galactosyltransferase; AltName: Full=Histo-blood group A transferase; Short=A transferase; AltName: Full=Histo-blood group B transferase; Short=B transferase; AltName: Full=N-acetylgalactosaminyltransferase A blood group-like enzyme; AltName: Full=NAGAT 1 [Rattus norvegicus]

Related Sequences to LMP012733 proteins

Reference Database Accession Length Protein Name
GI:148747204 GenBank AAF74758.2 348 N-acetylgalactosaminyltransferase A blood group-like enzyme [Rattus norvegicus]
GI:148747204 GenBank AAL82445.1 348 blood group A glycosyltransferase 1 [Rattus norvegicus]
GI:148747204 SwissProt Q9ET32.1 348 RecName: Full=Histo-blood group ABO system transferase 1; AltName: Full=Blood group A glycosyltransferase 1; AltName: Full=Cis-AB transferase 1; AltName: Full=Fucosylglycoprotein 3-alpha-galactosyltransferase; AltName: Full=Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase; AltName: Full=Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase; AltName: Full=Glycoprotein-fucosylgalactoside alpha-galactosyltransferase; AltName: Full=Histo-blood group A transferase; Short=A transferase; AltName: Full=Histo-blood group B transferase; Short=B transferase; AltName: Full=N-acetylgalactosaminyltransferase A blood group-like enzyme; AltName: Full=NAGAT 1 [Rattus norvegicus]