Gene/Proteome Database (LMPD)

LMPD ID
LMP012736
Gene ID
78959
Species
Rattus norvegicus (Rat)
Gene Name
aldo-keto reductase family 1, member A1 (aldehyde reductase)
Gene Symbol
Akr1a1
Synonyms
Akr1a4;
Alternate Names
alcohol dehydrogenase [NADP(+)]; aldehyde reductase; 3-DG-reducing enzyme; alcohol dehydrogenase; aldo-keto reductase family 1 member A1;
Chromosome
5
Map Location
5q36
EC Number
1.1.1.2
Summary
enzyme that catalyzes the NADPH-dependent reduction of 3-deoxyglucosone; important for detoxifying 3-deoxyglucosone when it is formed through the Maillard reaction in vivo [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Akr1a1

Proteins

alcohol dehydrogenase [NADP(+)]
Refseq ID NP_112262
Protein GI 13591894
UniProt ID P51635
mRNA ID NM_031000
Length 325
MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY

Gene Information

Entrez Gene ID
78959
Gene Name
aldo-keto reductase family 1, member A1 (aldehyde reductase)
Gene Symbol
Akr1a1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016324 IEA:Ensembl C apical plasma membrane
GO:0005829 IEA:Ensembl C cytosol
GO:0005615 IEA:Ensembl C extracellular space
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0047939 IEA:Ensembl F L-glucuronate reductase activity
GO:0008106 IEA:UniProtKB-EC F alcohol dehydrogenase (NADP+) activity
GO:0042840 IEA:Ensembl P D-glucuronate catabolic process
GO:0019853 IEA:Ensembl P L-ascorbic acid biosynthetic process
GO:0046185 IEA:Ensembl P aldehyde catabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko01220 Degradation of aromatic compounds
rno01220 Degradation of aromatic compounds
M00014 Glucuronate pathway (uronate pathway)
ko00561 Glycerolipid metabolism
rno00561 Glycerolipid metabolism
ko00010 Glycolysis / Gluconeogenesis
rno00010 Glycolysis / Gluconeogenesis
rno01100 Metabolic pathways
ko00040 Pentose and glucuronate interconversions
rno00040 Pentose and glucuronate interconversions

Domain Information

InterPro Annotations

Accession Description
IPR001395 Aldo/keto reductase
IPR020471 Aldo/keto reductase subgroup
IPR018170 Aldo/keto reductase, conserved site
IPR023210 NADP-dependent oxidoreductase domain

UniProt Annotations

Entry Information

Gene Name
aldo-keto reductase family 1, member A1 (aldehyde reductase)
Protein Entry
AK1A1_RAT
UniProt ID
P51635
Species
Rat

Comments

Comment Type Description
Catalytic Activity An alcohol + NADP(+) = an aldehyde + NADPH.
Function Catalyzes the NADPH-dependent reduction of a variety of aromatic and aliphatic aldehydes to their corresponding alcohols. Catalyzes the reduction of mevaldate to mevalonic acid and of glyceraldehyde to glycerol. Has broad substrate specificity. Plays a role in the activation of procarcinogens, such as polycyclic aromatic hydrocarbon trans-dihydrodiols, and in the metabolism of various xenobiotics and drugs (By similarity). Catalyzes the NADPH-dependent reduction of 3-deoxyglucosone (3-DG)
Similarity Belongs to the aldo/keto reductase family
Subunit Monomer

Identical and Related Proteins

Unique RefSeq proteins for LMP012736 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13591894 RefSeq NP_112262 325 alcohol dehydrogenase [NADP(+)]

Identical Sequences to LMP012736 proteins

Reference Database Accession Length Protein Name
GI:13591894 GenBank AAH59133.1 325 Aldo-keto reductase family 1, member A1 (aldehyde reductase) [Rattus norvegicus]
GI:13591894 GenBank EDL90265.1 325 aldo-keto reductase family 1, member A1, isoform CRA_a [Rattus norvegicus]
GI:13591894 GenBank ABZ68223.1 325 Sequence 36 from patent US 7326549
GI:13591894 SwissProt P51635.2 325 RecName: Full=Alcohol dehydrogenase [NADP(+)]; AltName: Full=3-DG-reducing enzyme; AltName: Full=Aldehyde reductase; AltName: Full=Aldo-keto reductase family 1 member A1 [Rattus norvegicus]

Related Sequences to LMP012736 proteins

Reference Database Accession Length Protein Name
GI:13591894 DBBJ BAA01627.1 325 aldehyde reductase [Rattus norvegicus]
GI:13591894 GenBank EDL90265.1 325 aldo-keto reductase family 1, member A1, isoform CRA_a [Rattus norvegicus]
GI:13591894 SwissProt P51635.2 325 RecName: Full=Alcohol dehydrogenase [NADP(+)]; AltName: Full=3-DG-reducing enzyme; AltName: Full=Aldehyde reductase; AltName: Full=Aldo-keto reductase family 1 member A1 [Rattus norvegicus]