Gene/Proteome Database (LMPD)
LMPD ID
LMP012747
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
hydroxyprostaglandin dehydrogenase 15 (NAD)
Gene Symbol
Alternate Names
15-hydroxyprostaglandin dehydrogenase [NAD(+)]; PGDH; 15-PGDH; prostaglandin dehydrogenase 1; 15-hydroxyprostaglandin dehydrogenase; NAD-dependent 15-hydroxyprostaglandin dehydrogenase;
Chromosome
16
Map Location
16p11
EC Number
1.1.1.141
Summary
NAD+-dependent 15-hydroxyprostaglandin dehydrogenase [RGD, Feb 2006]
Orthologs
Proteins
15-hydroxyprostaglandin dehydrogenase [NAD(+)] | |
---|---|
Refseq ID | NP_077366 |
Protein GI | 40538858 |
UniProt ID | O08699 |
mRNA ID | NM_024390 |
Length | 266 |
MHVNGKVALVTGAAQGIGKAFTEALLLHGAKVALVDWNLETGVKCKAALDEQFEPQKTLFIQCDVADQKQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEQTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINISSIAGLMPVAQQPVYCASKHGIIGFTRSAAMAANLMKSGVRLNVICPGFVKTPILESIEKEENMGQYIEYTDQIKAMMKFYGILDPSAIANGLINLIEDDALNGAIMKITASKGIHFQDYDLFPSFSKAP |
Gene Information
Entrez Gene ID
Gene Name
hydroxyprostaglandin dehydrogenase 15 (NAD)
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016323 | IEA:Ensembl | C | basolateral plasma membrane |
GO:0005737 | ISS:UniProtKB | C | cytoplasm |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0016404 | ISS:UniProtKB | F | 15-hydroxyprostaglandin dehydrogenase (NAD+) activity |
GO:0003824 | ISS:UniProtKB | F | catalytic activity |
GO:0051287 | ISS:UniProtKB | F | NAD binding |
GO:0070403 | ISS:UniProtKB | F | NAD+ binding |
GO:0004957 | ISS:UniProtKB | F | prostaglandin E receptor activity |
GO:0097070 | ISS:UniProtKB | P | ductus arteriosus closure |
GO:0007565 | ISS:UniProtKB | P | female pregnancy |
GO:0045786 | ISS:UniProtKB | P | negative regulation of cell cycle |
GO:0030728 | ISS:UniProtKB | P | ovulation |
GO:0007567 | ISS:UniProtKB | P | parturition |
GO:0006693 | ISS:UniProtKB | P | prostaglandin metabolic process |
GO:0070493 | IEP:UniProtKB | P | thrombin receptor signaling pathway |
GO:0007179 | ISS:UniProtKB | P | transforming growth factor beta receptor signaling pathway |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko05202 | Transcriptional misregulation in cancer |
rno05202 | Transcriptional misregulation in cancer |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxyprostaglandin dehydrogenase 15 (NAD)
Protein Entry
PGDH_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Catalytic Activity | (5Z,13E,15S)-11-alpha,15-dihydroxy-9-oxoprost- 5,13-dienoate + NAD(+) = (5Z,13E)-11-alpha-hydroxy-9,15- dioxoprost-5,13-dienoate + NADH. |
Function | Prostaglandin inactivation. Contributes to the regulation of events that are under the control of prostaglandin levels. Catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4 (By similarity) |
Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family |
Subcellular Location | Cytoplasm . |
Subunit | Homodimer |
Identical and Related Proteins
Unique RefSeq proteins for LMP012747 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
40538858 | RefSeq | NP_077366 | 266 | 15-hydroxyprostaglandin dehydrogenase [NAD(+)] |
Identical Sequences to LMP012747 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:40538858 | GenBank | AAH62399.1 | 266 | Hydroxyprostaglandin dehydrogenase 15 (NAD) [Rattus norvegicus] |
GI:40538858 | GenBank | EDL87138.1 | 266 | hydroxyprostaglandin dehydrogenase 15 (NAD) [Rattus norvegicus] |
GI:40538858 | SwissProt | O08699.2 | 266 | RecName: Full=15-hydroxyprostaglandin dehydrogenase [NAD(+)]; Short=15-PGDH; AltName: Full=Prostaglandin dehydrogenase 1 [Rattus norvegicus] |
Related Sequences to LMP012747 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:40538858 | GenBank | AAH62399.1 | 266 | Hydroxyprostaglandin dehydrogenase 15 (NAD) [Rattus norvegicus] |
GI:40538858 | GenBank | EDL87138.1 | 266 | hydroxyprostaglandin dehydrogenase 15 (NAD) [Rattus norvegicus] |
GI:40538858 | SwissProt | O08699.2 | 266 | RecName: Full=15-hydroxyprostaglandin dehydrogenase [NAD(+)]; Short=15-PGDH; AltName: Full=Prostaglandin dehydrogenase 1 [Rattus norvegicus] |