Gene/Proteome Database (LMPD)

LMPD ID
LMP012747
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
hydroxyprostaglandin dehydrogenase 15 (NAD)
Gene Symbol
Alternate Names
15-hydroxyprostaglandin dehydrogenase [NAD(+)]; PGDH; 15-PGDH; prostaglandin dehydrogenase 1; 15-hydroxyprostaglandin dehydrogenase; NAD-dependent 15-hydroxyprostaglandin dehydrogenase;
Chromosome
16
Map Location
16p11
EC Number
1.1.1.141
Summary
NAD+-dependent 15-hydroxyprostaglandin dehydrogenase [RGD, Feb 2006]
Orthologs

Proteins

15-hydroxyprostaglandin dehydrogenase [NAD(+)]
Refseq ID NP_077366
Protein GI 40538858
UniProt ID O08699
mRNA ID NM_024390
Length 266
MHVNGKVALVTGAAQGIGKAFTEALLLHGAKVALVDWNLETGVKCKAALDEQFEPQKTLFIQCDVADQKQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEQTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINISSIAGLMPVAQQPVYCASKHGIIGFTRSAAMAANLMKSGVRLNVICPGFVKTPILESIEKEENMGQYIEYTDQIKAMMKFYGILDPSAIANGLINLIEDDALNGAIMKITASKGIHFQDYDLFPSFSKAP

Gene Information

Entrez Gene ID
Gene Name
hydroxyprostaglandin dehydrogenase 15 (NAD)
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016323 IEA:Ensembl C basolateral plasma membrane
GO:0005737 ISS:UniProtKB C cytoplasm
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016404 ISS:UniProtKB F 15-hydroxyprostaglandin dehydrogenase (NAD+) activity
GO:0003824 ISS:UniProtKB F catalytic activity
GO:0051287 ISS:UniProtKB F NAD binding
GO:0070403 ISS:UniProtKB F NAD+ binding
GO:0004957 ISS:UniProtKB F prostaglandin E receptor activity
GO:0097070 ISS:UniProtKB P ductus arteriosus closure
GO:0007565 ISS:UniProtKB P female pregnancy
GO:0045786 ISS:UniProtKB P negative regulation of cell cycle
GO:0030728 ISS:UniProtKB P ovulation
GO:0007567 ISS:UniProtKB P parturition
GO:0006693 ISS:UniProtKB P prostaglandin metabolic process
GO:0070493 IEP:UniProtKB P thrombin receptor signaling pathway
GO:0007179 ISS:UniProtKB P transforming growth factor beta receptor signaling pathway

KEGG Pathway Links

KEGG Pathway ID Description
ko05202 Transcriptional misregulation in cancer
rno05202 Transcriptional misregulation in cancer

REACTOME Pathway Links

REACTOME Pathway ID Description
5953493 Arachidonic acid metabolism
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5954552 Synthesis of Lipoxins (LX)
5953492 Synthesis of Prostaglandins (PG) and Thromboxanes (TX)

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR020904 Short-chain dehydrogenase/reductase, conserved site
IPR002198 Short-chain dehydrogenase/reductase SDR

UniProt Annotations

Entry Information

Gene Name
hydroxyprostaglandin dehydrogenase 15 (NAD)
Protein Entry
PGDH_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity (5Z,13E,15S)-11-alpha,15-dihydroxy-9-oxoprost- 5,13-dienoate + NAD(+) = (5Z,13E)-11-alpha-hydroxy-9,15- dioxoprost-5,13-dienoate + NADH.
Function Prostaglandin inactivation. Contributes to the regulation of events that are under the control of prostaglandin levels. Catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4 (By similarity)
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family
Subcellular Location Cytoplasm .
Subunit Homodimer

Identical and Related Proteins

Unique RefSeq proteins for LMP012747 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
40538858 RefSeq NP_077366 266 15-hydroxyprostaglandin dehydrogenase [NAD(+)]

Identical Sequences to LMP012747 proteins

Reference Database Accession Length Protein Name
GI:40538858 GenBank AAH62399.1 266 Hydroxyprostaglandin dehydrogenase 15 (NAD) [Rattus norvegicus]
GI:40538858 GenBank EDL87138.1 266 hydroxyprostaglandin dehydrogenase 15 (NAD) [Rattus norvegicus]
GI:40538858 SwissProt O08699.2 266 RecName: Full=15-hydroxyprostaglandin dehydrogenase [NAD(+)]; Short=15-PGDH; AltName: Full=Prostaglandin dehydrogenase 1 [Rattus norvegicus]

Related Sequences to LMP012747 proteins

Reference Database Accession Length Protein Name
GI:40538858 GenBank AAH62399.1 266 Hydroxyprostaglandin dehydrogenase 15 (NAD) [Rattus norvegicus]
GI:40538858 GenBank EDL87138.1 266 hydroxyprostaglandin dehydrogenase 15 (NAD) [Rattus norvegicus]
GI:40538858 SwissProt O08699.2 266 RecName: Full=15-hydroxyprostaglandin dehydrogenase [NAD(+)]; Short=15-PGDH; AltName: Full=Prostaglandin dehydrogenase 1 [Rattus norvegicus]