Gene/Proteome Database (LMPD)

LMPD ID
LMP012753
Gene ID
80841
Species
Rattus norvegicus (Rat)
Gene Name
fatty acid binding protein 7, brain
Gene Symbol
Fabp7
Alternate Names
fatty acid-binding protein, brain; BLBP; B-FABP; brain lipid-binding protein; fatty acid-binding protein 7; brain-type fatty acid-binding protein;
Chromosome
20
Map Location
20q11
Summary
Brain-type fatty acid-binding protein; may bind docosahexaenoic acid (DHA) as a ligand; may play important role in CNS development [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Fabp7

Proteins

fatty acid-binding protein, brain
Refseq ID NP_110459
Protein GI 13540630
UniProt ID P55051
mRNA ID NM_030832
Length 132
MVDAFCATWKLTDSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGGKVVIRTQCTFKNTEISFQLGEEFEETSIDDRNCKSVIRLDGDKLIHVQKWDGKETNCVREIKDGKMVVTLTFGDVVAVRCYEKA

Gene Information

Entrez Gene ID
80841
Gene Name
fatty acid binding protein 7, brain
Gene Symbol
Fabp7
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0042995 IEA:Ensembl C cell projection
GO:0005737 IDA:RGD C cytoplasm
GO:0043025 IEA:Ensembl C neuronal cell body
GO:0005634 IDA:RGD C nucleus
GO:0005504 TAS:RGD F fatty acid binding
GO:0005215 IEA:InterPro F transporter activity
GO:0021846 IEA:Ensembl P cell proliferation in forebrain
GO:0050673 IMP:RGD P epithelial cell proliferation
GO:0022008 IEA:Ensembl P neurogenesis
GO:0060134 IEA:Ensembl P prepulse inhibition

KEGG Pathway Links

KEGG Pathway ID Description
ko03320 PPAR signaling pathway
rno03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 7, brain
Protein Entry
FABP7_RAT
UniProt ID
P55051
Species
Rat

Comments

Comment Type Description
Domain Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior
Function B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers.
Similarity Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family
Subcellular Location Cytoplasm.
Tissue Specificity Expressed in brain and other neural tissues.

Identical and Related Proteins

Unique RefSeq proteins for LMP012753 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13540630 RefSeq NP_110459 132 fatty acid-binding protein, brain

Identical Sequences to LMP012753 proteins

Reference Database Accession Length Protein Name
GI:13540630 GenBank AAA60455.1 132 fatty acid binding protein [Rattus norvegicus]
GI:13540630 GenBank EDL92887.1 132 fatty acid binding protein 7, brain, isoform CRA_a [Rattus norvegicus]
GI:13540630 SwissProt P55051.2 132 RecName: Full=Fatty acid-binding protein, brain; AltName: Full=Brain lipid-binding protein; Short=BLBP; AltName: Full=Brain-type fatty acid-binding protein; Short=B-FABP; AltName: Full=Fatty acid-binding protein 7 [Rattus norvegicus]

Related Sequences to LMP012753 proteins

Reference Database Accession Length Protein Name
GI:13540630 GenBank AAA60455.1 132 fatty acid binding protein [Rattus norvegicus]
GI:13540630 GenBank EDL92887.1 132 fatty acid binding protein 7, brain, isoform CRA_a [Rattus norvegicus]
GI:13540630 SwissProt P55051.2 132 RecName: Full=Fatty acid-binding protein, brain; AltName: Full=Brain lipid-binding protein; Short=BLBP; AltName: Full=Brain-type fatty acid-binding protein; Short=B-FABP; AltName: Full=Fatty acid-binding protein 7 [Rattus norvegicus]