Gene/Proteome Database (LMPD)
LMPD ID
LMP012779
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Gene Symbol
Synonyms
Siat9;
Alternate Names
lactosylceramide alpha-2,3-sialyltransferase; ST3GalV; ST3Gal V; GM3 synthase; ganglioside GM3 synthase; CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase); sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; GM3 synthase);
Chromosome
4
Map Location
4q33
EC Number
2.4.99.9
Summary
mouse homolog is an alpha 2,3-sialyltransferase that has activity toward lactosylceramide (LacCer) and synthesizes GM3 [RGD, Feb 2006]
Orthologs
Proteins
| lactosylceramide alpha-2,3-sialyltransferase | |
|---|---|
| Refseq ID | NP_112627 |
| Protein GI | 78126151 |
| UniProt ID | Q68G12 |
| mRNA ID | NM_031337 |
| Length | 387 |
| MPNEFTSAKLRSDCSRTSLQWYTQTQHKMRRPSLLLKDILKCMLVVFGVWLLYILKLNYTAEECDMKKLNYVDPARIKRAHRNTQEVFQKECRPGHAKKTMDLLFKGKYSMDLEPFVQKIPTASEAELKYDPPFGFRKFSSKVQSLLDMLPEHDFPEHLRAKHCKRCVVIGNGGILHGLELGHALNQFDVVIRLNSAPIEGYSEHVGNKTTIRMTYPEGAPLSDAEYYANDLFVAVLFKSVDFKWLQAMVKNESLPFWIRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGHDKNIPTIGIIAIVLATHLCDEVSLAGFGYDLSQPRTPLHYFDSQCMGAMNWQVMHNVTTETQFLQKLIKEGVVQDLSGGIH | |
Gene Information
Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
| GO:0047291 | ISS:UniProtKB | F | lactosylceramide alpha-2,3-sialyltransferase activity |
| GO:0006486 | IEA:InterPro | P | protein glycosylation |
| GO:0097503 | ISS:GOC | P | sialylation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00604 | Glycosphingolipid biosynthesis - ganglio series |
| rno00604 | Glycosphingolipid biosynthesis - ganglio series |
| M00069 | Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3 |
| rno01100 | Metabolic pathways |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5953739 | Asparagine N-linked glycosylation |
| 5953738 | Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein |
| 5953345 | Metabolism of proteins |
| 5953728 | Post-translational protein modification |
| 5954270 | Sialic acid metabolism |
| 5953737 | Synthesis of substrates in N-glycan biosythesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Protein Entry
SIAT9_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | CMP-N-acetylneuraminate + beta-D-galactosyl- (1->4)-beta-D-glucosyl-(1<->1)-ceramide = CMP + alpha-N- acetylneuraminyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl- (1<->1)-ceramide. |
| Function | Catalyzes the formation of ganglioside GM3 (alpha-N- acetylneuraminyl-2,3-beta-D-galactosyl-1, 4-beta-D- glucosylceramide) |
| Sequence Caution | Sequence=BAA33492.1; Type=Erroneous initiation; Evidence= ; |
| Similarity | Belongs to the glycosyltransferase 29 family |
| Subcellular Location | Golgi apparatus membrane ; Single-pass type II membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP012779 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 78126151 | RefSeq | NP_112627 | 387 | lactosylceramide alpha-2,3-sialyltransferase |
Identical Sequences to LMP012779 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:78126151 | GenBank | EDL91013.1 | 387 | ST3 beta-galactoside alpha-2,3-sialyltransferase 5 [Rattus norvegicus] |
| GI:78126151 | RefSeq | XP_006236739.1 | 387 | PREDICTED: lactosylceramide alpha-2,3-sialyltransferase isoform X1 [Rattus norvegicus] |
| GI:78126151 | RefSeq | XP_006236741.1 | 387 | PREDICTED: lactosylceramide alpha-2,3-sialyltransferase isoform X1 [Rattus norvegicus] |
| GI:78126151 | RefSeq | XP_008761218.1 | 387 | PREDICTED: lactosylceramide alpha-2,3-sialyltransferase isoform X1 [Rattus norvegicus] |
Related Sequences to LMP012779 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:78126151 | GenBank | EDL91013.1 | 387 | ST3 beta-galactoside alpha-2,3-sialyltransferase 5 [Rattus norvegicus] |
| GI:78126151 | RefSeq | XP_008761218.1 | 387 | PREDICTED: lactosylceramide alpha-2,3-sialyltransferase isoform X1 [Rattus norvegicus] |
| GI:78126151 | SwissProt | Q68G12.1 | 387 | RecName: Full=Lactosylceramide alpha-2,3-sialyltransferase; AltName: Full=CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; AltName: Full=Ganglioside GM3 synthase; AltName: Full=ST3Gal V; Short=ST3GalV; AltName: Full=Sialyltransferase 9 [Rattus norvegicus] |