Gene/Proteome Database (LMPD)
LMPD ID
LMP012779
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Gene Symbol
Synonyms
Siat9;
Alternate Names
lactosylceramide alpha-2,3-sialyltransferase; ST3GalV; ST3Gal V; GM3 synthase; ganglioside GM3 synthase; CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase); sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; GM3 synthase);
Chromosome
4
Map Location
4q33
EC Number
2.4.99.9
Summary
mouse homolog is an alpha 2,3-sialyltransferase that has activity toward lactosylceramide (LacCer) and synthesizes GM3 [RGD, Feb 2006]
Orthologs
Proteins
lactosylceramide alpha-2,3-sialyltransferase | |
---|---|
Refseq ID | NP_112627 |
Protein GI | 78126151 |
UniProt ID | Q68G12 |
mRNA ID | NM_031337 |
Length | 387 |
MPNEFTSAKLRSDCSRTSLQWYTQTQHKMRRPSLLLKDILKCMLVVFGVWLLYILKLNYTAEECDMKKLNYVDPARIKRAHRNTQEVFQKECRPGHAKKTMDLLFKGKYSMDLEPFVQKIPTASEAELKYDPPFGFRKFSSKVQSLLDMLPEHDFPEHLRAKHCKRCVVIGNGGILHGLELGHALNQFDVVIRLNSAPIEGYSEHVGNKTTIRMTYPEGAPLSDAEYYANDLFVAVLFKSVDFKWLQAMVKNESLPFWIRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGHDKNIPTIGIIAIVLATHLCDEVSLAGFGYDLSQPRTPLHYFDSQCMGAMNWQVMHNVTTETQFLQKLIKEGVVQDLSGGIH |
Gene Information
Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
GO:0047291 | ISS:UniProtKB | F | lactosylceramide alpha-2,3-sialyltransferase activity |
GO:0006486 | IEA:InterPro | P | protein glycosylation |
GO:0097503 | ISS:GOC | P | sialylation |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00604 | Glycosphingolipid biosynthesis - ganglio series |
rno00604 | Glycosphingolipid biosynthesis - ganglio series |
M00069 | Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3 |
rno01100 | Metabolic pathways |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5953739 | Asparagine N-linked glycosylation |
5953738 | Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein |
5953345 | Metabolism of proteins |
5953728 | Post-translational protein modification |
5954270 | Sialic acid metabolism |
5953737 | Synthesis of substrates in N-glycan biosythesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Protein Entry
SIAT9_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Catalytic Activity | CMP-N-acetylneuraminate + beta-D-galactosyl- (1->4)-beta-D-glucosyl-(1<->1)-ceramide = CMP + alpha-N- acetylneuraminyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl- (1<->1)-ceramide. |
Function | Catalyzes the formation of ganglioside GM3 (alpha-N- acetylneuraminyl-2,3-beta-D-galactosyl-1, 4-beta-D- glucosylceramide) |
Sequence Caution | Sequence=BAA33492.1; Type=Erroneous initiation; Evidence= ; |
Similarity | Belongs to the glycosyltransferase 29 family |
Subcellular Location | Golgi apparatus membrane ; Single-pass type II membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP012779 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
78126151 | RefSeq | NP_112627 | 387 | lactosylceramide alpha-2,3-sialyltransferase |
Identical Sequences to LMP012779 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:78126151 | GenBank | EDL91013.1 | 387 | ST3 beta-galactoside alpha-2,3-sialyltransferase 5 [Rattus norvegicus] |
GI:78126151 | RefSeq | XP_006236739.1 | 387 | PREDICTED: lactosylceramide alpha-2,3-sialyltransferase isoform X1 [Rattus norvegicus] |
GI:78126151 | RefSeq | XP_006236741.1 | 387 | PREDICTED: lactosylceramide alpha-2,3-sialyltransferase isoform X1 [Rattus norvegicus] |
GI:78126151 | RefSeq | XP_008761218.1 | 387 | PREDICTED: lactosylceramide alpha-2,3-sialyltransferase isoform X1 [Rattus norvegicus] |
Related Sequences to LMP012779 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:78126151 | GenBank | EDL91013.1 | 387 | ST3 beta-galactoside alpha-2,3-sialyltransferase 5 [Rattus norvegicus] |
GI:78126151 | RefSeq | XP_008761218.1 | 387 | PREDICTED: lactosylceramide alpha-2,3-sialyltransferase isoform X1 [Rattus norvegicus] |
GI:78126151 | SwissProt | Q68G12.1 | 387 | RecName: Full=Lactosylceramide alpha-2,3-sialyltransferase; AltName: Full=CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; AltName: Full=Ganglioside GM3 synthase; AltName: Full=ST3Gal V; Short=ST3GalV; AltName: Full=Sialyltransferase 9 [Rattus norvegicus] |