Gene/Proteome Database (LMPD)
LMPD ID
LMP012798
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
protein kinase, AMP-activated, beta 1 non-catalytic subunit
Gene Symbol
Alternate Names
5'-AMP-activated protein kinase subunit beta-1; AMPKb; AMPK beta-1 chain; AMPK subunit beta-1; 5-AMP-activated protein kinase beta subunit; 5'-AMP-activated protein kinase, beta subunit; 5'-AMP-activated protein kinase 40 kDa subunit;
Chromosome
12
Map Location
12q16
Summary
may facilitate the association of the heterotrimeric AMP-activated protein kinase; may phosphorylate and inactivate enzymes involved in lipid metabolism; may play a role in response to metabolic stress [RGD, Feb 2006]
Orthologs
Proteins
| 5'-AMP-activated protein kinase subunit beta-1 | |
|---|---|
| Refseq ID | NP_114182 |
| Protein GI | 14010877 |
| UniProt ID | P80386 |
| mRNA ID | NM_031976 |
| Length | 270 |
| MGNTSSERAALERQAGHKTPRRDSSEGTKDGDRPKILMDSPEDADIFHTEEMKAPEKEEFLAWQHDLEVNEKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYISKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI | |
Gene Information
Entrez Gene ID
Gene Name
protein kinase, AMP-activated, beta 1 non-catalytic subunit
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031588 | IDA:RGD | C | AMP-activated protein kinase complex |
| GO:0005634 | IEA:Ensembl | C | nucleus |
| GO:0043234 | IDA:RGD | C | protein complex |
| GO:0004672 | IEA:Ensembl | F | protein kinase activity |
| GO:0019901 | IPI:RGD | F | protein kinase binding |
| GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
| GO:0010628 | IEA:Ensembl | P | positive regulation of gene expression |
| GO:0051291 | IDA:RGD | P | protein heterooligomerization |
| GO:0050790 | IDA:RGD | P | regulation of catalytic activity |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko04152 | AMPK signaling pathway |
| rno04152 | AMPK signaling pathway |
| ko04920 | Adipocytokine signaling pathway |
| rno04920 | Adipocytokine signaling pathway |
| ko04710 | Circadian rhythm |
| rno04710 | Circadian rhythm |
| rno04068 | FoxO signaling pathway |
| ko05410 | Hypertrophic cardiomyopathy (HCM) |
| rno05410 | Hypertrophic cardiomyopathy (HCM) |
| ko04910 | Insulin signaling pathway |
| rno04910 | Insulin signaling pathway |
| ko04932 | Non-alcoholic fatty liver disease (NAFLD) |
| rno04932 | Non-alcoholic fatty liver disease (NAFLD) |
| ko04921 | Oxytocin signaling pathway |
| rno04921 | Oxytocin signaling pathway |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5954481 | Activation of PPARGC1A (PGC-1alpha) by phosphorylation |
| 5954019 | Energy dependent regulation of mTOR by LKB1-AMPK |
| 5953430 | IGF1R signaling cascade |
| 5953428 | IRS-mediated signalling |
| 5953425 | IRS-related events |
| 5953429 | IRS-related events triggered by IGF1R |
| 5953422 | Insulin receptor signalling cascade |
| 5953916 | Membrane Trafficking |
| 5953600 | Mitochondrial biogenesis |
| 5953601 | Organelle biogenesis and maintenance |
| 5953432 | PI3K Cascade |
| 5953733 | PKB-mediated events |
| 5954018 | Regulation of AMPK activity via LKB1 |
| 5954161 | Regulation of Rheb GTPase activity by AMPK |
| 5953381 | Signal Transduction |
| 5953423 | Signaling by Insulin receptor |
| 5953431 | Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R) |
| 5954455 | Translocation of GLUT4 to the plasma membrane |
| 5953766 | mTOR signalling |
Domain Information
UniProt Annotations
Entry Information
Gene Name
protein kinase, AMP-activated, beta 1 non-catalytic subunit
Protein Entry
AAKB1_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Domain | The glycogen-binding domain may target AMPK to glycogen so that other factors like glycogen-bound debranching enzyme or protein phosphatases can directly affect AMPK activity |
| Function | Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3). |
| Ptm | Phosphorylated when associated with the catalytic subunit (PRKAA1 or PRKAA2). Phosphorylated by ULK1; leading to negatively regulate AMPK activity and suggesting the existence of a regulatory feedback loop between ULK1 and AMPK. {ECO:0000269|PubMed:11171104, ECO:0000269|PubMed:12764152, ECO:0000269|PubMed:21460634, ECO:0000269|PubMed:9305909}. |
| Similarity | Belongs to the 5'-AMP-activated protein kinase beta subunit family |
| Subunit | AMPK is a heterotrimer of an alpha catalytic subunit (PRKAA1 or PRKAA2), a beta (PRKAB1 or PRKAB2) and a gamma non- catalytic subunits (PRKAG1, PRKAG2 or PRKAG3). Interacts with FNIP1 and FNIP2 |
| Tissue Specificity | Highly expressed in kidney, heart, white adipose tissue, lung and spleen. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012798 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 14010877 | RefSeq | NP_114182 | 270 | 5'-AMP-activated protein kinase subunit beta-1 |
Identical Sequences to LMP012798 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:14010877 | GenBank | AAC52579.1 | 270 | 5'-AMP-activated protein kinase, beta subunit [Rattus norvegicus] |
Related Sequences to LMP012798 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:14010877 | EMBL | CAA64830.1 | 270 | AMP-activated protein kinase beta [Rattus norvegicus] |
| GI:14010877 | GenBank | AAC52579.1 | 270 | 5'-AMP-activated protein kinase, beta subunit [Rattus norvegicus] |
| GI:14010877 | RefSeq | XP_006249543.1 | 270 | PREDICTED: 5'-AMP-activated protein kinase subunit beta-1 isoform X1 [Rattus norvegicus] |