Gene/Proteome Database (LMPD)

LMPD ID
LMP012805
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 12
Gene Symbol
Alternate Names
estradiol 17-beta-dehydrogenase 12; KAR; 17-beta-HSD 12; 3-ketoacyl-CoA reductase; 17-beta-hydroxysteroid dehydrogenase 12; smooth muscle-specific 17 beta-hydroxysteroid dehydrogenase type 3;
Chromosome
3
Map Location
3q31
EC Number
1.1.1.62
Summary
may play a role in steroid metabolism [RGD, Feb 2006]
Orthologs

Proteins

estradiol 17-beta-dehydrogenase 12
Refseq ID NP_114455
Protein GI 14091750
UniProt ID Q6P7R8
mRNA ID NM_032066
Length 291
MERALPAAGFLYWVGASTIAYLTLRASYSLFRAFQVWCVGNQAFVGPRLGEWAVVTGGTDGIGKSYAEELAKRGMKIVLISRSQDKLKEVSNNIKEKFNVETRTIAVDFSLDDIYDKIKTGLSGLEIGVLVNNVGMSYEYPEYFLEIPDLDNTIKKLININVLSICKVTRLVLPGMVERSKGVILNISSASGMLPVPLLTVYSATKAFVDFFSQCLHEEYKSKGIFVQSVLPFFVSTKLAKIRKPTLDKPSAETFVKSAIKTVGLQTRTTGICDPRHHGLNKLNLAPLDLF

Gene Information

Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 12
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0031012 IEA:Ensembl C extracellular matrix
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0004303 IEA:UniProtKB-EC F estradiol 17-beta-dehydrogenase activity
GO:0008201 IEA:Ensembl F heparin binding
GO:0006703 IEA:UniProtKB-UniPathway P estrogen biosynthetic process
GO:0030198 IEA:Ensembl P extracellular matrix organization
GO:0006633 IEA:UniProtKB-UniPathway P fatty acid biosynthetic process
GO:0010811 IEA:Ensembl P positive regulation of cell-substrate adhesion

KEGG Pathway Links

KEGG Pathway ID Description
ko01040 Biosynthesis of unsaturated fatty acids
rno01040 Biosynthesis of unsaturated fatty acids
M00415 Fatty acid biosynthesis, elongation, endoplasmic reticulum
ko00062 Fatty acid elongation
rno00062 Fatty acid elongation
ko01212 Fatty acid metabolism
rno01212 Fatty acid metabolism
rno01100 Metabolic pathways
ko00140 Steroid hormone biosynthesis
rno00140 Steroid hormone biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953463 Fatty Acyl-CoA Biosynthesis
5953288 Fatty acid, triacylglycerol, and ketone body metabolism
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953471 Synthesis of very long-chain fatty acyl-CoAs
5953464 Triglyceride Biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
hydroxysteroid (17-beta) dehydrogenase 12
Protein Entry
DHB12_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity 17-beta-estradiol + NAD(P)(+) = estrone + NAD(P)H.
Domain The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins
Function Catalyzes the transformation of estrone (E1) into estradiol (E2), suggesting a central role in estrogen formation. Its strong expression in ovary and mammary gland suggest that it may constitute the major enzyme responsible for the conversion of E1 to E2 in females. Also has 3-ketoacyl-CoA reductase activity, reducing both long chain 3-ketoacyl-CoAs and long chain fatty acyl-CoAs, suggesting a role in long fatty acid elongation (By similarity)
Pathway Lipid metabolism; fatty acid biosynthesis.
Pathway Steroid biosynthesis; estrogen biosynthesis.
Sequence Caution Sequence=AAD00504.1; Type=Frameshift; Positions=272; Evidence= ;
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein .

Identical and Related Proteins

Unique RefSeq proteins for LMP012805 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
14091750 RefSeq NP_114455 291 estradiol 17-beta-dehydrogenase 12

Identical Sequences to LMP012805 proteins

Reference Database Accession Length Protein Name
GI:14091750 GenBank AAD00504.1 291 smooth muscle-specific 17beta-hydroxysteroid dehydrogenase type 3 [Rattus norvegicus]

Related Sequences to LMP012805 proteins

Reference Database Accession Length Protein Name
GI:14091750 GenBank AAD00504.1 291 smooth muscle-specific 17beta-hydroxysteroid dehydrogenase type 3 [Rattus norvegicus]
GI:14091750 GenBank EDL79606.1 312 hydroxysteroid (17-beta) dehydrogenase 12, isoform CRA_b [Rattus norvegicus]
GI:14091750 RefSeq XP_006234661.1 312 PREDICTED: estradiol 17-beta-dehydrogenase 12 isoform X1 [Rattus norvegicus]