Gene/Proteome Database (LMPD)
LMPD ID
LMP012805
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 12
Gene Symbol
Alternate Names
estradiol 17-beta-dehydrogenase 12; KAR; 17-beta-HSD 12; 3-ketoacyl-CoA reductase; 17-beta-hydroxysteroid dehydrogenase 12; smooth muscle-specific 17 beta-hydroxysteroid dehydrogenase type 3;
Chromosome
3
Map Location
3q31
EC Number
1.1.1.62
Summary
may play a role in steroid metabolism [RGD, Feb 2006]
Orthologs
Proteins
| estradiol 17-beta-dehydrogenase 12 | |
|---|---|
| Refseq ID | NP_114455 |
| Protein GI | 14091750 |
| UniProt ID | Q6P7R8 |
| mRNA ID | NM_032066 |
| Length | 291 |
| MERALPAAGFLYWVGASTIAYLTLRASYSLFRAFQVWCVGNQAFVGPRLGEWAVVTGGTDGIGKSYAEELAKRGMKIVLISRSQDKLKEVSNNIKEKFNVETRTIAVDFSLDDIYDKIKTGLSGLEIGVLVNNVGMSYEYPEYFLEIPDLDNTIKKLININVLSICKVTRLVLPGMVERSKGVILNISSASGMLPVPLLTVYSATKAFVDFFSQCLHEEYKSKGIFVQSVLPFFVSTKLAKIRKPTLDKPSAETFVKSAIKTVGLQTRTTGICDPRHHGLNKLNLAPLDLF | |
Gene Information
Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 12
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0031012 | IEA:Ensembl | C | extracellular matrix |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0004303 | IEA:UniProtKB-EC | F | estradiol 17-beta-dehydrogenase activity |
| GO:0008201 | IEA:Ensembl | F | heparin binding |
| GO:0006703 | IEA:UniProtKB-UniPathway | P | estrogen biosynthetic process |
| GO:0030198 | IEA:Ensembl | P | extracellular matrix organization |
| GO:0006633 | IEA:UniProtKB-UniPathway | P | fatty acid biosynthetic process |
| GO:0010811 | IEA:Ensembl | P | positive regulation of cell-substrate adhesion |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko01040 | Biosynthesis of unsaturated fatty acids |
| rno01040 | Biosynthesis of unsaturated fatty acids |
| M00415 | Fatty acid biosynthesis, elongation, endoplasmic reticulum |
| ko00062 | Fatty acid elongation |
| rno00062 | Fatty acid elongation |
| ko01212 | Fatty acid metabolism |
| rno01212 | Fatty acid metabolism |
| rno01100 | Metabolic pathways |
| ko00140 | Steroid hormone biosynthesis |
| rno00140 | Steroid hormone biosynthesis |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxysteroid (17-beta) dehydrogenase 12
Protein Entry
DHB12_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 17-beta-estradiol + NAD(P)(+) = estrone + NAD(P)H. |
| Domain | The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins |
| Function | Catalyzes the transformation of estrone (E1) into estradiol (E2), suggesting a central role in estrogen formation. Its strong expression in ovary and mammary gland suggest that it may constitute the major enzyme responsible for the conversion of E1 to E2 in females. Also has 3-ketoacyl-CoA reductase activity, reducing both long chain 3-ketoacyl-CoAs and long chain fatty acyl-CoAs, suggesting a role in long fatty acid elongation (By similarity) |
| Pathway | Lipid metabolism; fatty acid biosynthesis. |
| Pathway | Steroid biosynthesis; estrogen biosynthesis. |
| Sequence Caution | Sequence=AAD00504.1; Type=Frameshift; Positions=272; Evidence= ; |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP012805 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 14091750 | RefSeq | NP_114455 | 291 | estradiol 17-beta-dehydrogenase 12 |
Identical Sequences to LMP012805 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:14091750 | GenBank | AAD00504.1 | 291 | smooth muscle-specific 17beta-hydroxysteroid dehydrogenase type 3 [Rattus norvegicus] |
Related Sequences to LMP012805 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:14091750 | GenBank | AAD00504.1 | 291 | smooth muscle-specific 17beta-hydroxysteroid dehydrogenase type 3 [Rattus norvegicus] |
| GI:14091750 | GenBank | EDL79606.1 | 312 | hydroxysteroid (17-beta) dehydrogenase 12, isoform CRA_b [Rattus norvegicus] |
| GI:14091750 | RefSeq | XP_006234661.1 | 312 | PREDICTED: estradiol 17-beta-dehydrogenase 12 isoform X1 [Rattus norvegicus] |