Gene/Proteome Database (LMPD)
LMPD ID
LMP012820
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
fucosyltransferase 9 (alpha (1,3) fucosyltransferase)
Gene Symbol
Alternate Names
alpha-(1,3)-fucosyltransferase 9; fuc-TIX; fucT-IX; fucosyltransferase IX; galactoside 3-L-fucosyltransferase;
Chromosome
5
Map Location
5q21
EC Number
2.4.1.-
Summary
catalyzes the last step of Lewis x biosynthesis; plays a critical role in the embryonic brain patterning and neurogenesis [RGD, Feb 2006]
Orthologs
Proteins
| alpha-(1,3)-fucosyltransferase 9 | |
|---|---|
| Refseq ID | NP_445917 |
| Protein GI | 16758212 |
| UniProt ID | Q99JB3 |
| mRNA ID | NM_053465 |
| Length | 359 |
| MTSTSKGILRPFLIVCIILGCFVACLLIYIKPTNSWVFSPMESASSVLKMKNFFSRKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTSPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDFNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN | |
Gene Information
Entrez Gene ID
Gene Name
fucosyltransferase 9 (alpha (1,3) fucosyltransferase)
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0046920 | IEA:Ensembl | F | alpha-(1->3)-fucosyltransferase activity |
| GO:0008417 | NAS:RGD | F | fucosyltransferase activity |
| GO:0036065 | NAS:GOC | P | fucosylation |
| GO:0007399 | IDA:RGD | P | nervous system development |
| GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00603 | Glycosphingolipid biosynthesis - globo series |
| rno00603 | Glycosphingolipid biosynthesis - globo series |
| ko00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
| rno00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
| rno01100 | Metabolic pathways |
| ko00514 | Other types of O-glycan biosynthesis |
| rno00514 | Other types of O-glycan biosynthesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001503 | Glycosyl transferase, family 10 |
UniProt Annotations
Entry Information
Gene Name
fucosyltransferase 9 (alpha (1,3) fucosyltransferase)
Protein Entry
FUT9_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Function | Transfers a fucose to lacto-N-neotetraose but not to either alpha2,3-sialyl lacto-N-neotetraose or lacto-N-tetraose. Can catalyze the last step in the biosynthesis of Lewis antigen, the addition of a fucose to precursor polysaccharides (By similarity) |
| Pathway | Protein modification; protein glycosylation. |
| Similarity | Belongs to the glycosyltransferase 10 family |
| Subcellular Location | Golgi apparatus, Golgi stack membrane {ECO:0000250}; Single-pass type II membrane protein . Note=Membrane-bound form in trans cisternae of Golgi |
Identical and Related Proteins
Unique RefSeq proteins for LMP012820 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16758212 | RefSeq | NP_445917 | 359 | alpha-(1,3)-fucosyltransferase 9 |
Identical Sequences to LMP012820 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16758212 | GenBank | EDL98546.1 | 359 | fucosyltransferase 9 [Rattus norvegicus] |
| GI:16758212 | GenBank | AFG79860.1 | 359 | Sequence 119 from patent US 8137928 |
| GI:16758212 | RefSeq | XP_008761820.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 isoform X1 [Rattus norvegicus] |
| GI:16758212 | SwissProt | Q99JB3.1 | 359 | RecName: Full=Alpha-(1,3)-fucosyltransferase 9; AltName: Full=Fucosyltransferase 9; AltName: Full=Fucosyltransferase IX; Short=Fuc-TIX; Short=FucT-IX; AltName: Full=Galactoside 3-L-fucosyltransferase [Rattus norvegicus] |
Related Sequences to LMP012820 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16758212 | GenBank | EDL98546.1 | 359 | fucosyltransferase 9 [Rattus norvegicus] |
| GI:16758212 | GenBank | AFG79860.1 | 359 | Sequence 119 from patent US 8137928 |
| GI:16758212 | RefSeq | XP_008761820.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 isoform X1 [Rattus norvegicus] |