Gene/Proteome Database (LMPD)
LMPD ID
LMP012830
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
isopentenyl-diphosphate delta isomerase 1
Gene Symbol
Alternate Names
isopentenyl-diphosphate Delta-isomerase 1; IPPI1; IPP isomerase 1; isopentenyl pyrophosphate isomerase 1;
Chromosome
17
Map Location
17q12.1
EC Number
5.3.3.2
Summary
catalyzes the interconversion of isopentenyl diphosphate to dimethylallyl diphosphate; an important component of the isoprenoid biosynthetic pathway [RGD, Feb 2006]
Orthologs
Proteins
isopentenyl-diphosphate Delta-isomerase 1 | |
---|---|
Refseq ID | NP_445991 |
Protein GI | 399567836 |
UniProt ID | O35760 |
mRNA ID | NM_053539 |
Length | 283 |
MWRGRALAGVIGSALKGRGLEAEHAAESVEVRRSAQLLDTPLWNRCVLGQIRHSVTMPEINASNLDEKQVQLLAEMCILIDENDNKIGADTKKNCHLNENIDKGLIHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNSCCSHPLNNPGELEENDAMGVKRAAQRRLKAELGIPLEEVDLNEMNYLTRIYYKAQSDGIWGEHEIDYILFLRKNVTLNPDPNEIKSYCYVSKEELKEILKKEARGEIKLTPWFKIIADAFLFKWWDNLNHLSPFVDHEKIHRM |
Gene Information
Entrez Gene ID
Gene Name
isopentenyl-diphosphate delta isomerase 1
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005739 | IEA:Ensembl | C | mitochondrion |
GO:0005777 | IDA:RGD | C | peroxisome |
GO:0016787 | IEA:InterPro | F | hydrolase activity |
GO:0004452 | TAS:RGD | F | isopentenyl-diphosphate delta-isomerase activity |
GO:0000287 | IEA:Ensembl | F | magnesium ion binding |
GO:0030145 | IEA:Ensembl | F | manganese ion binding |
GO:0006695 | TAS:RGD | P | cholesterol biosynthetic process |
GO:0050992 | IEA:UniProtKB-UniPathway | P | dimethylallyl diphosphate biosynthetic process |
GO:0008299 | IEA:UniProtKB-KW | P | isoprenoid biosynthetic process |
GO:0035634 | IEA:Ensembl | P | response to stilbenoid |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
M00095 | C5 isoprenoid biosynthesis, mevalonate pathway |
rno01100 | Metabolic pathways |
ko00900 | Terpenoid backbone biosynthesis |
rno00900 | Terpenoid backbone biosynthesis |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
isopentenyl-diphosphate delta isomerase 1
Protein Entry
IDI1_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Isopentenyl diphosphate = dimethylallyl diphosphate. |
Cofactor | Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence= ; Note=Binds 1 Mg(2+) ion per subunit. ; |
Function | Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP). |
Pathway | Isoprenoid biosynthesis; dimethylallyl diphosphate biosynthesis; dimethylallyl diphosphate from isopentenyl diphosphate: step 1/1. |
Similarity | Belongs to the IPP isomerase type 1 family |
Similarity | Contains 1 nudix hydrolase domain |
Subcellular Location | Peroxisome. |
Subunit | Monomer |
Identical and Related Proteins
Unique RefSeq proteins for LMP012830 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
399567836 | RefSeq | NP_445991 | 283 | isopentenyl-diphosphate Delta-isomerase 1 |
Identical Sequences to LMP012830 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:399567836 | GenBank | EDL86437.1 | 283 | isopentenyl-diphosphate delta isomerase [Rattus norvegicus] |
Related Sequences to LMP012830 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:399567836 | GenBank | EDL32280.1 | 283 | isopentenyl-diphosphate delta isomerase [Mus musculus] |
GI:399567836 | GenBank | EDL86437.1 | 283 | isopentenyl-diphosphate delta isomerase [Rattus norvegicus] |
GI:399567836 | RefSeq | NP_663335.2 | 283 | isopentenyl-diphosphate Delta-isomerase 1 [Mus musculus] |