Gene/Proteome Database (LMPD)

LMPD ID
LMP012837
Gene ID
94167
Species
Rattus norvegicus (Rat)
Gene Name
peroxiredoxin 6
Gene Symbol
Prdx6
Alternate Names
peroxiredoxin-6; NSGPx; aiPLA2; 1-Cys PRX; 1-Cys peroxiredoxin; antioxidant protein 2; thiol-specific antioxidant protein; non-selenium glutathione peroxidase; acidic calcium-independent phospholipase A2;
Chromosome
13
Map Location
13q22
EC Number
1.11.1.15
Summary
catalyzes the catabolism of hydrogen peroxide and organic hydroperoxides [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Prdx6

Proteins

peroxiredoxin-6
Refseq ID NP_446028
Protein GI 16758348
UniProt ID O35244
mRNA ID NM_053576
Length 224
MPGGLLLGDEAPNFEANTTIGHIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHFAWSKDINAYNGAAPTEKLPFPIIDDKDRDLAILLGMLDPAEKDEKGMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTASNPVATPVDWKKGESVMVLPTLPEEEAKQLFPKGVFTKELPSGKKYLRYTPQP

Gene Information

Entrez Gene ID
94167
Gene Name
peroxiredoxin 6
Gene Symbol
Prdx6
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 ISS:UniProtKB C cytoplasm
GO:0031410 IEA:UniProtKB-KW C cytoplasmic vesicle
GO:0005615 IEA:Ensembl C extracellular space
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005764 IEA:UniProtKB-KW C lysosome
GO:0004602 IDA:RGD F glutathione peroxidase activity
GO:0051920 IEA:UniProtKB-EC F peroxiredoxin activity
GO:0004623 IEA:Ensembl F phospholipase A2 activity
GO:0042744 IDA:RGD P hydrogen peroxide catabolic process
GO:0009395 IEA:Ensembl P phospholipid catabolic process

KEGG Pathway Links

KEGG Pathway ID Description
rno01100 Metabolic pathways
ko00360 Phenylalanine metabolism
rno00360 Phenylalanine metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5953238 Cellular responses to stress
5953323 Detoxification of Reactive Oxygen Species

Domain Information

InterPro Annotations

Accession Description
IPR000866 Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant
IPR024706 Peroxiredoxin, AhpC-type
IPR019479 Peroxiredoxin, C-terminal
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
peroxiredoxin 6
Protein Entry
PRDX6_RAT
UniProt ID
O35244
Species
Rat

Comments

Comment Type Description
Catalytic Activity 2 R'-SH + ROOH = R'-S-S-R' + H(2)O + ROH.
Catalytic Activity 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.
Function Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.
Interaction P62258:YWHAE (xeno); NbExp=2; IntAct=EBI-915490, EBI-356498; P62259:Ywhae (xeno); NbExp=2; IntAct=EBI-915490, EBI-356480;
Miscellaneous Irreversibly inactivated by overoxidation of Cys-47 (to Cys-SO(3)H) upon oxidative stress
Miscellaneous The active site is the redox-active Cys-47 oxidized to Cys-SOH. Unlike 2-Cys peroxiredoxins, PRDX6 conserves only this peroxidatic cysteine. To regenerate and activate the enzyme, the oxidized form is directly reduced to cysteine by glutathione and not thioredoxin.
Similarity Belongs to the AhpC/TSA family. Rehydrin subfamily
Similarity Contains 1 thioredoxin domain. {ECO:0000255|PROSITE- ProRule:PRU00691}.
Subcellular Location Cytoplasm. Lysosome. Cytoplasmic vesicle . Note=Also found in lung secretory organelles.
Subunit Homotetramer. Interacts with GSTP1; mediates PRDX6 glutathionylation and regeneration. May interact with HTR2A. Interacts with APEX1 and STH (By similarity). May interact with FAM168B (By similarity)

Identical and Related Proteins

Unique RefSeq proteins for LMP012837 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16758348 RefSeq NP_446028 224 peroxiredoxin-6

Identical Sequences to LMP012837 proteins

Reference Database Accession Length Protein Name
GI:16758348 GenBank EDM09416.1 224 peroxiredoxin 6, isoform CRA_a [Rattus norvegicus]
GI:16758348 GenBank AEU43352.1 224 Sequence 101 from patent US 8052970
GI:16758348 GenBank AEU43484.1 224 Sequence 233 from patent US 8052970
GI:16758348 SwissProt O35244.3 224 RecName: Full=Peroxiredoxin-6; AltName: Full=1-Cys peroxiredoxin; Short=1-Cys PRX; AltName: Full=Acidic calcium-independent phospholipase A2; Short=aiPLA2; AltName: Full=Antioxidant protein 2; AltName: Full=Non-selenium glutathione peroxidase; Short=NSGPx; AltName: Full=Thiol-specific antioxidant protein [Rattus norvegicus]

Related Sequences to LMP012837 proteins

Reference Database Accession Length Protein Name
GI:16758348 EMBL CAA76732.1 224 thiol-specific antioxidant protein [Rattus norvegicus]
GI:16758348 GenBank AEU43352.1 224 Sequence 101 from patent US 8052970
GI:16758348 SwissProt O35244.3 224 RecName: Full=Peroxiredoxin-6; AltName: Full=1-Cys peroxiredoxin; Short=1-Cys PRX; AltName: Full=Acidic calcium-independent phospholipase A2; Short=aiPLA2; AltName: Full=Antioxidant protein 2; AltName: Full=Non-selenium glutathione peroxidase; Short=NSGPx; AltName: Full=Thiol-specific antioxidant protein [Rattus norvegicus]