Gene/Proteome Database (LMPD)
LMPD ID
LMP012841
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Gene Symbol
Synonyms
DRCF-5;
Alternate Names
diphosphoinositol polyphosphate phosphohydrolase 2; DIPP-2; rDIPP2; nudix motif 4; nudix-type motif 4; nucleoside diphosphate-linked moiety X motif 4; diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 2; diphosphoinositol polyphosphate phosphohydolase type II;
Chromosome
7
Map Location
7q13
EC Number
3.6.1.52
Summary
a diphosphoinositol polyphosphate phosphohydrolase that displays increased expression in the frontal cortex in response to extended lithium treatment [RGD, Feb 2006]
Orthologs
Proteins
| diphosphoinositol polyphosphate phosphohydrolase 2 | |
|---|---|
| Refseq ID | NP_446050 |
| Protein GI | 16758972 |
| UniProt ID | Q99MY2 |
| mRNA ID | NM_053598 |
| Length | 179 |
| MKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGVEPEEEPGGAAAREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLERLKLGCSPTNGNSTVPSLPDNNALFVTAAPPSGVPSSIR | |
Gene Information
Entrez Gene ID
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0008486 | ISS:UniProtKB | F | diphosphoinositol-polyphosphate diphosphatase activity |
| GO:0052840 | IEA:UniProtKB-EC | F | inositol diphosphate tetrakisphosphate diphosphatase activity |
| GO:0052846 | IEA:UniProtKB-EC | F | inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 1-diphosphatase activity |
| GO:0052847 | IEA:UniProtKB-EC | F | inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity |
| GO:0052843 | IEA:UniProtKB-EC | F | inositol-1-diphosphate-2,3,4,5,6-pentakisphosphate diphosphatase activity |
| GO:0052848 | IEA:UniProtKB-EC | F | inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity |
| GO:0052844 | IEA:UniProtKB-EC | F | inositol-3-diphosphate-1,2,4,5,6-pentakisphosphate diphosphatase activity |
| GO:0052845 | IEA:UniProtKB-EC | F | inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0030515 | ISS:UniProtKB | F | snoRNA binding |
| GO:0046488 | NAS:RGD | P | phosphatidylinositol metabolic process |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Protein Entry
NUDT4_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Diphospho-myo-inositol polyphosphate + H(2)O = myo-inositol polyphosphate + phosphate. |
| Cofactor | Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence= ; Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence= ; Note=Binds 3 Mg(2+) or Mn(2+) ions per subunit. ; |
| Function | Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), PP-InsP4 and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphate Ap6A, but not Ap5A. The major reaction products are ADP and p4a from Ap6A. Also able to hydrolyze 5-phosphoribose 1-diphosphate. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA (By similarity) |
| Induction | Overexpressed in frontal cortex upon chronic lithium treatment |
| Similarity | Belongs to the Nudix hydrolase family. DIPP subfamily |
| Similarity | Contains 1 nudix hydrolase domain |
| Subcellular Location | Cytoplasm . |
Identical and Related Proteins
Unique RefSeq proteins for LMP012841 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16758972 | RefSeq | NP_446050 | 179 | diphosphoinositol polyphosphate phosphohydrolase 2 |
Identical Sequences to LMP012841 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16758972 | GenBank | AAK29279.1 | 179 | diphosphoinositol polyphosphate phosphohydolase type II [Rattus norvegicus] |
| GI:16758972 | GenBank | EDM16850.1 | 179 | rCG48717, isoform CRA_a [Rattus norvegicus] |
| GI:16758972 | SwissProt | Q99MY2.1 | 179 | RecName: Full=Diphosphoinositol polyphosphate phosphohydrolase 2; Short=DIPP-2; Short=rDIPP2; AltName: Full=Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 2; AltName: Full=Nucleoside diphosphate-linked moiety X motif 4; Short=Nudix motif 4 [Rattus norvegicus] |
Related Sequences to LMP012841 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16758972 | GenBank | AAK29279.1 | 179 | diphosphoinositol polyphosphate phosphohydolase type II [Rattus norvegicus] |
| GI:16758972 | GenBank | EDM16850.1 | 179 | rCG48717, isoform CRA_a [Rattus norvegicus] |
| GI:16758972 | SwissProt | Q99MY2.1 | 179 | RecName: Full=Diphosphoinositol polyphosphate phosphohydrolase 2; Short=DIPP-2; Short=rDIPP2; AltName: Full=Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 2; AltName: Full=Nucleoside diphosphate-linked moiety X motif 4; Short=Nudix motif 4 [Rattus norvegicus] |