Gene/Proteome Database (LMPD)

LMPD ID
LMP012841
Gene ID
94267
Species
Rattus norvegicus (Rat)
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Gene Symbol
Nudt4
Synonyms
DRCF-5;
Alternate Names
diphosphoinositol polyphosphate phosphohydrolase 2; DIPP-2; rDIPP2; nudix motif 4; nudix-type motif 4; nucleoside diphosphate-linked moiety X motif 4; diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 2; diphosphoinositol polyphosphate phosphohydolase type II;
Chromosome
7
Map Location
7q13
EC Number
3.6.1.52
Summary
a diphosphoinositol polyphosphate phosphohydrolase that displays increased expression in the frontal cortex in response to extended lithium treatment [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Nudt4

Proteins

diphosphoinositol polyphosphate phosphohydrolase 2
Refseq ID NP_446050
Protein GI 16758972
UniProt ID Q99MY2
mRNA ID NM_053598
Length 179
MKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGVEPEEEPGGAAAREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLERLKLGCSPTNGNSTVPSLPDNNALFVTAAPPSGVPSSIR

Gene Information

Entrez Gene ID
94267
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Gene Symbol
Nudt4
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0008486 ISS:UniProtKB F diphosphoinositol-polyphosphate diphosphatase activity
GO:0052846 IEA:UniProtKB-EC F inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 1-diphosphatase activity
GO:0052847 IEA:UniProtKB-EC F inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity
GO:0052843 IEA:UniProtKB-EC F inositol-1-diphosphate-2,3,4,5,6-pentakisphosphate diphosphatase activity
GO:0052848 IEA:UniProtKB-EC F inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity
GO:0052844 IEA:UniProtKB-EC F inositol-3-diphosphate-1,2,4,5,6-pentakisphosphate diphosphatase activity
GO:0052845 IEA:UniProtKB-EC F inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity
GO:0052840 IEA:UniProtKB-EC F inositol diphosphate tetrakisphosphate diphosphatase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0030515 ISS:UniProtKB F snoRNA binding
GO:0046488 NAS:RGD P phosphatidylinositol metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
5954515 Inositol phosphate metabolism
5953250 Metabolism
5954518 Synthesis of pyrophosphates in the cytosol

Domain Information

InterPro Annotations

Accession Description
IPR020084 NUDIX hydrolase, conserved site
IPR000086 NUDIX hydrolase domain
IPR015797 NUDIX hydrolase domain-like

UniProt Annotations

Entry Information

Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Protein Entry
NUDT4_RAT
UniProt ID
Q99MY2
Species
Rat

Comments

Comment Type Description
Catalytic Activity Diphospho-myo-inositol polyphosphate + H(2)O = myo-inositol polyphosphate + phosphate.
Cofactor Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence= ; Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence= ; Note=Binds 3 Mg(2+) or Mn(2+) ions per subunit. ;
Function Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), PP-InsP4 and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphate Ap6A, but not Ap5A. The major reaction products are ADP and p4a from Ap6A. Also able to hydrolyze 5-phosphoribose 1-diphosphate. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA (By similarity)
Induction Overexpressed in frontal cortex upon chronic lithium treatment
Similarity Belongs to the Nudix hydrolase family. DIPP subfamily
Similarity Contains 1 nudix hydrolase domain
Subcellular Location Cytoplasm .

Identical and Related Proteins

Unique RefSeq proteins for LMP012841 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16758972 RefSeq NP_446050 179 diphosphoinositol polyphosphate phosphohydrolase 2

Identical Sequences to LMP012841 proteins

Reference Database Accession Length Protein Name
GI:16758972 GenBank AAK29279.1 179 diphosphoinositol polyphosphate phosphohydolase type II [Rattus norvegicus]
GI:16758972 GenBank EDM16850.1 179 rCG48717, isoform CRA_a [Rattus norvegicus]
GI:16758972 SwissProt Q99MY2.1 179 RecName: Full=Diphosphoinositol polyphosphate phosphohydrolase 2; Short=DIPP-2; Short=rDIPP2; AltName: Full=Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 2; AltName: Full=Nucleoside diphosphate-linked moiety X motif 4; Short=Nudix motif 4 [Rattus norvegicus]

Related Sequences to LMP012841 proteins

Reference Database Accession Length Protein Name
GI:16758972 GenBank AAK29279.1 179 diphosphoinositol polyphosphate phosphohydolase type II [Rattus norvegicus]
GI:16758972 GenBank EDM16850.1 179 rCG48717, isoform CRA_a [Rattus norvegicus]
GI:16758972 SwissProt Q99MY2.1 179 RecName: Full=Diphosphoinositol polyphosphate phosphohydrolase 2; Short=DIPP-2; Short=rDIPP2; AltName: Full=Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 2; AltName: Full=Nucleoside diphosphate-linked moiety X motif 4; Short=Nudix motif 4 [Rattus norvegicus]