Gene/Proteome Database (LMPD)

LMPD ID
LMP012843
Gene ID
94340
Species
Rattus norvegicus (Rat)
Gene Name
acyl-CoA synthetase long-chain family member 5
Gene Symbol
Acsl5
Synonyms
Acs5; Facl5;
Alternate Names
long-chain-fatty-acid--CoA ligase 5; LACS 5; long-chain acyl-CoA synthetase 5; long-chain fatty acid coenzyme A ligase 5; fatty acid Coenzyme A ligase, long chain 5;
Chromosome
1
Map Location
1q55
EC Number
6.2.1.3
Summary
catalyzes the ligation of a fatty acid to produce acyl Co-A; has preferential activity for C16-C18 unsaturated fatty acids [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Acsl5

Proteins

long-chain-fatty-acid--CoA ligase 5
Refseq ID NP_446059
Protein GI 16758398
UniProt ID O88813
mRNA ID NM_053607
Length 683
MLFIFNFLFSPLPTPALICLLTFGTAIFLWLINRPQPVLPLIDLDNQSVGIEGGARRGAFQKNNDLILYYFSDAKTLYEVFQRGLAVSDNGPCLGYRKPNQPYKWISYKQVSDRAEYLGSCLLHKGYKPSQDQFIGIFAQNRPEWVISELACYTYSMVAVPLYDTLGAEAIIYVINRADISVVICDTPQKATMLIENVEKDLTPGLKTVILMDPFDDDLMKRGEKCGIEMLSLHDAENLGKENFKKPMPPNPEDLSVICFTSGTTGDPKGAMLTHQNIVSNMAAFLKFLEPIFQPTPEDVTISYLPLAHMFERLVQGVIFSCGGKIGFFQGDIRLLPDDMKALKPTVFPTVPRLLNRVYDKVQNEAKTPLKKFLLNLAIISKFNEVRNGIIRRNSLWDKLVFSKIQSSLGGKVRLMITGAAPISTPVLTFFRAAMGCWVFEAYGQTECTAGCSITSPGDWTAGHVGTPVSCNFVKLEDVADMNYFSVNNEGEICIKGNNVFKGYLKDPEKTQEVLDKDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENVYSRSRPILQVFVHGESLRSFLIGVVVPDPESLPSFAAKIGVKGSFEELCQNQCVKKAILEDLQKVGKEGGLKSFEQVKSIFVHPEPFSIENGLLTPTLKAKRVELAKFFQTQIKSLYESIEE

Gene Information

Entrez Gene ID
94340
Gene Name
acyl-CoA synthetase long-chain family member 5
Gene Symbol
Acsl5
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005741 IEA:UniProtKB-KW C mitochondrial outer membrane
GO:0005739 IDA:RGD C mitochondrion
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0004467 IDA:RGD F long-chain fatty acid-CoA ligase activity
GO:0032869 IEP:RGD P cellular response to insulin stimulus
GO:0006631 TAS:RGD P fatty acid metabolic process
GO:0015908 IGI:RGD P fatty acid transport
GO:0001676 IDA:GOC P long-chain fatty acid metabolic process
GO:0008654 IGI:RGD P phospholipid biosynthetic process
GO:0032000 IGI:RGD P positive regulation of fatty acid beta-oxidation
GO:0010747 IDA:RGD P positive regulation of plasma membrane long-chain fatty acid transport
GO:0010867 IDA:RGD P positive regulation of triglyceride biosynthetic process
GO:0070723 IEP:RGD P response to cholesterol
GO:0009749 IEP:RGD P response to glucose
GO:0007584 IEP:RGD P response to nutrient
GO:0009744 IEP:RGD P response to sucrose

KEGG Pathway Links

KEGG Pathway ID Description
ko04920 Adipocytokine signaling pathway
rno04920 Adipocytokine signaling pathway
ko00061 Fatty acid biosynthesis
rno00061 Fatty acid biosynthesis
ko00071 Fatty acid degradation
rno00071 Fatty acid degradation
ko01212 Fatty acid metabolism
rno01212 Fatty acid metabolism
rno01100 Metabolic pathways
ko03320 PPAR signaling pathway
rno03320 PPAR signaling pathway
ko04146 Peroxisome
rno04146 Peroxisome
M00086 beta-Oxidation, acyl-CoA synthesis

Domain Information

InterPro Annotations

Accession Description
IPR020845 AMP-binding, conserved site
IPR000873 AMP-dependent synthetase/ligase

UniProt Annotations

Entry Information

Gene Name
acyl-CoA synthetase long-chain family member 5
Protein Entry
ACSL5_RAT
UniProt ID
O88813
Species
Rat

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=666 uM for ATP ; KM=2.4 uM for CoA ; KM=8.6 uM for palmitate ; Vmax=130 nmol/min/mg enzyme with palmitate as substrate ;
Catalytic Activity ATP + a long-chain fatty acid + CoA = AMP + diphosphate + an acyl-CoA.
Function Acyl-CoA synthetases (ACSL) activates long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL5 may sensitize epithelial cells to apoptosis specifically triggered by the death ligand TRAIL at the villus tip of the crypt-villus axis of the small intestine (By similarity). May have a role in the survival of glioma cells (By similarity). May activate fatty acids from exogenous sources for the synthesis of triacylglycerol destined for intracellular storage. It was suggested that it may also stimulate fatty acid oxidation. Utilizes a wide range of saturated fatty acids with a preference for C16-C18 unsaturated fatty acids. {ECO:0000250, ECO:0000269|PubMed:16263710, ECO:0000269|PubMed:17761945, ECO:0000269|PubMed:9722683}.
Induction Expression decreases in response to fast and increases after high sucrose diet
Miscellaneous 5 rat isozymes encoded by different genes have been described. ACSL6 corresponds to isozyme 2 (ACS2)
Similarity Belongs to the ATP-dependent AMP-binding enzyme family
Subcellular Location Mitochondrion . Endoplasmic reticulum . Mitochondrion outer membrane ; Single-pass type III membrane protein . Endoplasmic reticulum membrane ; Single-pass type III membrane protein .
Tissue Specificity Expressed most abundantly in the small intestine, and to a much lesser extent in the lung, liver, adrenal gland, adipose tissue and kidney

Identical and Related Proteins

Unique RefSeq proteins for LMP012843 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16758398 RefSeq NP_446059 683 long-chain-fatty-acid--CoA ligase 5

Identical Sequences to LMP012843 proteins

Reference Database Accession Length Protein Name
GI:16758398 DBBJ BAA33581.1 683 acyl-CoA synthetase 5 [Rattus norvegicus]
GI:16758398 SwissProt O88813.1 683 RecName: Full=Long-chain-fatty-acid--CoA ligase 5; AltName: Full=Long-chain acyl-CoA synthetase 5; Short=LACS 5 [Rattus norvegicus]

Related Sequences to LMP012843 proteins

Reference Database Accession Length Protein Name
GI:16758398 DBBJ BAA33581.1 683 acyl-CoA synthetase 5 [Rattus norvegicus]
GI:16758398 GenBank AAH72497.1 683 Acyl-CoA synthetase long-chain family member 5 [Rattus norvegicus]
GI:16758398 SwissProt O88813.1 683 RecName: Full=Long-chain-fatty-acid--CoA ligase 5; AltName: Full=Long-chain acyl-CoA synthetase 5; Short=LACS 5 [Rattus norvegicus]