Gene/Proteome Database (LMPD)
LMPD ID
LMP012843
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
acyl-CoA synthetase long-chain family member 5
Gene Symbol
Synonyms
Acs5; Facl5;
Alternate Names
long-chain-fatty-acid--CoA ligase 5; LACS 5; long-chain acyl-CoA synthetase 5; long-chain fatty acid coenzyme A ligase 5; fatty acid Coenzyme A ligase, long chain 5;
Chromosome
1
Map Location
1q55
EC Number
6.2.1.3
Summary
catalyzes the ligation of a fatty acid to produce acyl Co-A; has preferential activity for C16-C18 unsaturated fatty acids [RGD, Feb 2006]
Orthologs
Proteins
long-chain-fatty-acid--CoA ligase 5 | |
---|---|
Refseq ID | NP_446059 |
Protein GI | 16758398 |
UniProt ID | O88813 |
mRNA ID | NM_053607 |
Length | 683 |
MLFIFNFLFSPLPTPALICLLTFGTAIFLWLINRPQPVLPLIDLDNQSVGIEGGARRGAFQKNNDLILYYFSDAKTLYEVFQRGLAVSDNGPCLGYRKPNQPYKWISYKQVSDRAEYLGSCLLHKGYKPSQDQFIGIFAQNRPEWVISELACYTYSMVAVPLYDTLGAEAIIYVINRADISVVICDTPQKATMLIENVEKDLTPGLKTVILMDPFDDDLMKRGEKCGIEMLSLHDAENLGKENFKKPMPPNPEDLSVICFTSGTTGDPKGAMLTHQNIVSNMAAFLKFLEPIFQPTPEDVTISYLPLAHMFERLVQGVIFSCGGKIGFFQGDIRLLPDDMKALKPTVFPTVPRLLNRVYDKVQNEAKTPLKKFLLNLAIISKFNEVRNGIIRRNSLWDKLVFSKIQSSLGGKVRLMITGAAPISTPVLTFFRAAMGCWVFEAYGQTECTAGCSITSPGDWTAGHVGTPVSCNFVKLEDVADMNYFSVNNEGEICIKGNNVFKGYLKDPEKTQEVLDKDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENVYSRSRPILQVFVHGESLRSFLIGVVVPDPESLPSFAAKIGVKGSFEELCQNQCVKKAILEDLQKVGKEGGLKSFEQVKSIFVHPEPFSIENGLLTPTLKAKRVELAKFFQTQIKSLYESIEE |
Gene Information
Entrez Gene ID
Gene Name
acyl-CoA synthetase long-chain family member 5
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005741 | IEA:UniProtKB-KW | C | mitochondrial outer membrane |
GO:0005739 | IDA:RGD | C | mitochondrion |
GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
GO:0004467 | IDA:RGD | F | long-chain fatty acid-CoA ligase activity |
GO:0032869 | IEP:RGD | P | cellular response to insulin stimulus |
GO:0006631 | TAS:RGD | P | fatty acid metabolic process |
GO:0015908 | IGI:RGD | P | fatty acid transport |
GO:0001676 | IDA:GOC | P | long-chain fatty acid metabolic process |
GO:0008654 | IGI:RGD | P | phospholipid biosynthetic process |
GO:0032000 | IGI:RGD | P | positive regulation of fatty acid beta-oxidation |
GO:0010747 | IDA:RGD | P | positive regulation of plasma membrane long-chain fatty acid transport |
GO:0010867 | IDA:RGD | P | positive regulation of triglyceride biosynthetic process |
GO:0070723 | IEP:RGD | P | response to cholesterol |
GO:0009749 | IEP:RGD | P | response to glucose |
GO:0007584 | IEP:RGD | P | response to nutrient |
GO:0009744 | IEP:RGD | P | response to sucrose |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko04920 | Adipocytokine signaling pathway |
rno04920 | Adipocytokine signaling pathway |
M00086 | beta-Oxidation, acyl-CoA synthesis |
ko00061 | Fatty acid biosynthesis |
rno00061 | Fatty acid biosynthesis |
ko00071 | Fatty acid degradation |
rno00071 | Fatty acid degradation |
ko01212 | Fatty acid metabolism |
rno01212 | Fatty acid metabolism |
rno01100 | Metabolic pathways |
ko04146 | Peroxisome |
rno04146 | Peroxisome |
ko03320 | PPAR signaling pathway |
rno03320 | PPAR signaling pathway |
Domain Information
UniProt Annotations
Entry Information
Gene Name
acyl-CoA synthetase long-chain family member 5
Protein Entry
ACSL5_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Biophysicochemical Properties | Kinetic parameters: KM=666 uM for ATP ; KM=2.4 uM for CoA ; KM=8.6 uM for palmitate ; Vmax=130 nmol/min/mg enzyme with palmitate as substrate ; |
Catalytic Activity | ATP + a long-chain fatty acid + CoA = AMP + diphosphate + an acyl-CoA. |
Function | Acyl-CoA synthetases (ACSL) activates long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL5 may sensitize epithelial cells to apoptosis specifically triggered by the death ligand TRAIL at the villus tip of the crypt-villus axis of the small intestine (By similarity). May have a role in the survival of glioma cells (By similarity). May activate fatty acids from exogenous sources for the synthesis of triacylglycerol destined for intracellular storage. It was suggested that it may also stimulate fatty acid oxidation. Utilizes a wide range of saturated fatty acids with a preference for C16-C18 unsaturated fatty acids. {ECO:0000250, ECO:0000269|PubMed:16263710, ECO:0000269|PubMed:17761945, ECO:0000269|PubMed:9722683}. |
Induction | Expression decreases in response to fast and increases after high sucrose diet |
Miscellaneous | 5 rat isozymes encoded by different genes have been described. ACSL6 corresponds to isozyme 2 (ACS2) |
Similarity | Belongs to the ATP-dependent AMP-binding enzyme family |
Subcellular Location | Mitochondrion . Endoplasmic reticulum . Mitochondrion outer membrane ; Single-pass type III membrane protein . Endoplasmic reticulum membrane ; Single-pass type III membrane protein . |
Tissue Specificity | Expressed most abundantly in the small intestine, and to a much lesser extent in the lung, liver, adrenal gland, adipose tissue and kidney |
Identical and Related Proteins
Unique RefSeq proteins for LMP012843 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
16758398 | RefSeq | NP_446059 | 683 | long-chain-fatty-acid--CoA ligase 5 |
Identical Sequences to LMP012843 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16758398 | DBBJ | BAA33581.1 | 683 | acyl-CoA synthetase 5 [Rattus norvegicus] |
GI:16758398 | SwissProt | O88813.1 | 683 | RecName: Full=Long-chain-fatty-acid--CoA ligase 5; AltName: Full=Long-chain acyl-CoA synthetase 5; Short=LACS 5 [Rattus norvegicus] |
Related Sequences to LMP012843 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16758398 | DBBJ | BAA33581.1 | 683 | acyl-CoA synthetase 5 [Rattus norvegicus] |
GI:16758398 | GenBank | AAH72497.1 | 683 | Acyl-CoA synthetase long-chain family member 5 [Rattus norvegicus] |
GI:16758398 | SwissProt | O88813.1 | 683 | RecName: Full=Long-chain-fatty-acid--CoA ligase 5; AltName: Full=Long-chain acyl-CoA synthetase 5; Short=LACS 5 [Rattus norvegicus] |