Gene/Proteome Database (LMPD)

LMPD ID
LMP012853
Gene ID
114097
Species
Rattus norvegicus (Rat)
Gene Name
leukotriene C4 synthase
Gene Symbol
Ltc4s
Alternate Names
leukotriene C4 synthase; LTC4 synthase; leukotriene-C(4) synthase;
Chromosome
10
Map Location
10q22
EC Number
4.4.1.20
Summary
conjugates leukotriene LTA4 with reduced glutathione (GSH) to form LTC4, mediates inflammatory responses in mast cells, eosinophils, basophils, monocytes-macrophages, and platelets [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Ltc4s

Proteins

leukotriene C4 synthase
Refseq ID NP_446091
Protein GI 18777699
UniProt ID Q925U2
mRNA ID NM_053639
Length 150
MKEETALLATVTLVGVLLQAYFSLQVISARRTFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQHRLDPLYASARALWLLVAMAALGLLVHFLPGTLRAALFRWLQVLLPMA

Gene Information

Entrez Gene ID
114097
Gene Name
leukotriene C4 synthase
Gene Symbol
Ltc4s
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IBA:RefGenome C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0043231 IDA:RGD C intracellular membrane-bounded organelle
GO:0005635 IBA:RefGenome C nuclear envelope
GO:0008047 IEA:InterPro F enzyme activator activity
GO:0043295 IDA:RGD F glutathione binding
GO:0004602 IBA:RefGenome F glutathione peroxidase activity
GO:0004364 IBA:RefGenome F glutathione transferase activity
GO:0004464 IDA:RGD F leukotriene-C4 synthase activity
GO:0046982 IPI:RGD F protein heterodimerization activity
GO:0071222 IEP:RGD P cellular response to lipopolysaccharide
GO:0071299 IEP:RGD P cellular response to vitamin A
GO:0019370 IDA:RGD P leukotriene biosynthetic process
GO:0055114 IBA:GOC P oxidation-reduction process
GO:0048678 IEP:RGD P response to axon injury
GO:0042493 IEP:RGD P response to drug
GO:0010035 IEP:RGD P response to inorganic substance
GO:0032496 IEP:RGD P response to lipopolysaccharide

KEGG Pathway Links

KEGG Pathway ID Description
ko00590 Arachidonic acid metabolism
rno00590 Arachidonic acid metabolism
rno01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR001446 5-lipoxygenase-activating protein
IPR018295 FLAP/GST2/LTC4S, conserved site
IPR023352 Membrane associated eicosanoid/glutathione metabolism-like domain
IPR001129 Membrane-associated, eicosanoid/glutathione metabolism (MAPEG) protein

UniProt Annotations

Entry Information

Gene Name
leukotriene C4 synthase
Protein Entry
LTC4S_RAT
UniProt ID
Q925U2
Species
Rat

Comments

Comment Type Description
Catalytic Activity Leukotriene C(4) = leukotriene A(4) + glutathione.
Function Catalyzes the conjugation of leukotriene A4 with reduced glutathione to form leukotriene C4
Induction Up-regulated by all-trans retinoic acid
Similarity Belongs to the MAPEG family
Subcellular Location Nucleus outer membrane ; Multi- pass membrane protein . Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein .
Subunit Homotrimer. Interacts with ALOX5AP and ALOX5 (By similarity)

Identical and Related Proteins

Unique RefSeq proteins for LMP012853 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18777699 RefSeq NP_446091 150 leukotriene C4 synthase

Identical Sequences to LMP012853 proteins

Reference Database Accession Length Protein Name
GI:18777699 DBBJ BAB58882.2 150 leukotriene C4 synthase [Rattus norvegicus]
GI:18777699 SwissProt Q925U2.2 150 RecName: Full=Leukotriene C4 synthase; Short=LTC4 synthase; AltName: Full=Leukotriene-C(4) synthase [Rattus norvegicus]

Related Sequences to LMP012853 proteins

Reference Database Accession Length Protein Name
GI:18777699 DBBJ BAB58882.2 150 leukotriene C4 synthase [Rattus norvegicus]
GI:18777699 RefSeq XP_008765877.1 150 PREDICTED: leukotriene C4 synthase isoform X1 [Rattus norvegicus]
GI:18777699 SwissProt Q925U2.2 150 RecName: Full=Leukotriene C4 synthase; Short=LTC4 synthase; AltName: Full=Leukotriene-C(4) synthase [Rattus norvegicus]