Gene/Proteome Database (LMPD)
LMPD ID
LMP012857
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
Gene Symbol
Alternate Names
phosphatidate cytidylyltransferase 2; CDS 2; CDP-DG synthase 2; CDP-DAG synthase 2; CDP-DG synthetase 2; CDP-diglyceride synthase 2; CDP-diglyceride synthetase 2; CDP-diacylglycerol synthase 2; CDP-diglyceride pyrophosphorylase 2; CTP:phosphatidate cytidylyltransferase 2;
Chromosome
3
Map Location
3q36
EC Number
2.7.7.41
Summary
mitochondrial membrane protein that is important for the biosynthesis of phosphatidylglycerol and phosphatidylinositol [RGD, Feb 2006]
Orthologs
Proteins
phosphatidate cytidylyltransferase 2 | |
---|---|
Refseq ID | NP_446095 |
Protein GI | 16758454 |
UniProt ID | Q91XU8 |
mRNA ID | NM_053643 |
Length | 443 |
MTELRQRAVREDAPPEDKESESEAKLDGETASDSESRAETAPPPTSIDDTPEVLNRALSNLSSRWKNWWVRGILTMAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSLVGWKTMRMYPFQIHSALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLKSHLTDKGILMSALEEE |
Gene Information
Entrez Gene ID
Gene Name
CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005743 | IEA:UniProtKB-KW | C | mitochondrial inner membrane |
GO:0004605 | IEA:UniProtKB-EC | F | phosphatidate cytidylyltransferase activity |
GO:0016024 | IEA:UniProtKB-UniPathway | P | CDP-diacylglycerol biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00564 | Glycerophospholipid metabolism |
rno00564 | Glycerophospholipid metabolism |
rno01100 | Metabolic pathways |
ko04070 | Phosphatidylinositol signaling system |
rno04070 | Phosphatidylinositol signaling system |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
Protein Entry
CDS2_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Catalytic Activity | CTP + phosphatidate = diphosphate + CDP- diacylglycerol. |
Function | Provides CDP-diacylglycerol, an important precursor for the synthesis of phosphatidylinositol, phosphatidylglycerol, and cardiolipin |
Pathway | Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 3/3. |
Similarity | Belongs to the CDS family |
Subcellular Location | Mitochondrion inner membrane ; Multi-pass membrane protein ; Matrix side . |
Identical and Related Proteins
Unique RefSeq proteins for LMP012857 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
16758454 | RefSeq | NP_446095 | 443 | phosphatidate cytidylyltransferase 2 |
Identical Sequences to LMP012857 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16758454 | DBBJ | BAB61043.1 | 443 | CDP-diacylglycerol synthase type2 [Rattus norvegicus] |
GI:16758454 | SwissProt | Q91XU8.1 | 443 | RecName: Full=Phosphatidate cytidylyltransferase 2; AltName: Full=CDP-DAG synthase 2; AltName: Full=CDP-DG synthase 2; AltName: Full=CDP-diacylglycerol synthase 2; Short=CDS 2; AltName: Full=CDP-diglyceride pyrophosphorylase 2; AltName: Full=CDP-diglyceride synthase 2; AltName: Full=CTP:phosphatidate cytidylyltransferase 2 [Rattus norvegicus] |
Related Sequences to LMP012857 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16758454 | DBBJ | BAB61043.1 | 443 | CDP-diacylglycerol synthase type2 [Rattus norvegicus] |
GI:16758454 | GenBank | EDL80261.1 | 444 | CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 [Rattus norvegicus] |
GI:16758454 | SwissProt | Q91XU8.1 | 443 | RecName: Full=Phosphatidate cytidylyltransferase 2; AltName: Full=CDP-DAG synthase 2; AltName: Full=CDP-DG synthase 2; AltName: Full=CDP-diacylglycerol synthase 2; Short=CDS 2; AltName: Full=CDP-diglyceride pyrophosphorylase 2; AltName: Full=CDP-diglyceride synthase 2; AltName: Full=CTP:phosphatidate cytidylyltransferase 2 [Rattus norvegicus] |