Gene/Proteome Database (LMPD)

LMPD ID
LMP012857
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
Gene Symbol
Alternate Names
phosphatidate cytidylyltransferase 2; CDS 2; CDP-DG synthase 2; CDP-DAG synthase 2; CDP-DG synthetase 2; CDP-diglyceride synthase 2; CDP-diglyceride synthetase 2; CDP-diacylglycerol synthase 2; CDP-diglyceride pyrophosphorylase 2; CTP:phosphatidate cytidylyltransferase 2;
Chromosome
3
Map Location
3q36
EC Number
2.7.7.41
Summary
mitochondrial membrane protein that is important for the biosynthesis of phosphatidylglycerol and phosphatidylinositol [RGD, Feb 2006]
Orthologs

Proteins

phosphatidate cytidylyltransferase 2
Refseq ID NP_446095
Protein GI 16758454
UniProt ID Q91XU8
mRNA ID NM_053643
Length 443
MTELRQRAVREDAPPEDKESESEAKLDGETASDSESRAETAPPPTSIDDTPEVLNRALSNLSSRWKNWWVRGILTMAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSLVGWKTMRMYPFQIHSALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLKSHLTDKGILMSALEEE

Gene Information

Entrez Gene ID
Gene Name
CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005743 IEA:UniProtKB-KW C mitochondrial inner membrane
GO:0004605 IEA:UniProtKB-EC F phosphatidate cytidylyltransferase activity
GO:0016024 IEA:UniProtKB-UniPathway P CDP-diacylglycerol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00564 Glycerophospholipid metabolism
rno00564 Glycerophospholipid metabolism
rno01100 Metabolic pathways
ko04070 Phosphatidylinositol signaling system
rno04070 Phosphatidylinositol signaling system

REACTOME Pathway Links

REACTOME Pathway ID Description
5953473 Glycerophospholipid biosynthesis
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953474 Phospholipid metabolism
5954473 Synthesis of PG

Domain Information

InterPro Annotations

Accession Description
IPR000374 Phosphatidate cytidylyltransferase
IPR016720 Phosphatidate cytidylyltransferase, eukaryota

UniProt Annotations

Entry Information

Gene Name
CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
Protein Entry
CDS2_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity CTP + phosphatidate = diphosphate + CDP- diacylglycerol.
Function Provides CDP-diacylglycerol, an important precursor for the synthesis of phosphatidylinositol, phosphatidylglycerol, and cardiolipin
Pathway Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 3/3.
Similarity Belongs to the CDS family
Subcellular Location Mitochondrion inner membrane ; Multi-pass membrane protein ; Matrix side .

Identical and Related Proteins

Unique RefSeq proteins for LMP012857 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16758454 RefSeq NP_446095 443 phosphatidate cytidylyltransferase 2

Identical Sequences to LMP012857 proteins

Reference Database Accession Length Protein Name
GI:16758454 DBBJ BAB61043.1 443 CDP-diacylglycerol synthase type2 [Rattus norvegicus]
GI:16758454 SwissProt Q91XU8.1 443 RecName: Full=Phosphatidate cytidylyltransferase 2; AltName: Full=CDP-DAG synthase 2; AltName: Full=CDP-DG synthase 2; AltName: Full=CDP-diacylglycerol synthase 2; Short=CDS 2; AltName: Full=CDP-diglyceride pyrophosphorylase 2; AltName: Full=CDP-diglyceride synthase 2; AltName: Full=CTP:phosphatidate cytidylyltransferase 2 [Rattus norvegicus]

Related Sequences to LMP012857 proteins

Reference Database Accession Length Protein Name
GI:16758454 DBBJ BAB61043.1 443 CDP-diacylglycerol synthase type2 [Rattus norvegicus]
GI:16758454 GenBank EDL80261.1 444 CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 [Rattus norvegicus]
GI:16758454 SwissProt Q91XU8.1 443 RecName: Full=Phosphatidate cytidylyltransferase 2; AltName: Full=CDP-DAG synthase 2; AltName: Full=CDP-DG synthase 2; AltName: Full=CDP-diacylglycerol synthase 2; Short=CDS 2; AltName: Full=CDP-diglyceride pyrophosphorylase 2; AltName: Full=CDP-diglyceride synthase 2; AltName: Full=CTP:phosphatidate cytidylyltransferase 2 [Rattus norvegicus]