Gene/Proteome Database (LMPD)

LMPD ID
LMP012859
Gene ID
114113
Species
Rattus norvegicus (Rat)
Gene Name
platelet-activating factor acetylhydrolase 1b, catalytic subunit 3
Gene Symbol
Pafah1b3
Alternate Names
platelet-activating factor acetylhydrolase IB subunit gamma; PAF-AH alpha 1; PAFAH subunit gamma; PAF-AH subunit gamma; PAF-AH 29 kDa subunit; PAF acetylhydrolase 29 kDa subunit; platelet-activating factor acetylhydrolase alpha 1 subunit; platelet-activating factor acetylhydrolase, isoform 1b, subunit 3; platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit; platelet-activating factor acetylhydrolase, isoform 1b, alpha1 subunit;
Chromosome
1
Map Location
1q21
EC Number
3.1.1.47
Summary
subunit of the brain intracellular platelet-activating factor acetylhydrolase, which is composed of alpha1, alpha2, and beta subunits [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Pafah1b3

Proteins

platelet-activating factor acetylhydrolase IB subunit gamma
Refseq ID NP_446106
Protein GI 16758470
UniProt ID O35263
mRNA ID NM_053654
Length 232
MSGEGENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHSHTAEQVTGGIKAIVQLVNKLQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGYPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGIPLPETAP

Gene Information

Entrez Gene ID
114113
Gene Name
platelet-activating factor acetylhydrolase 1b, catalytic subunit 3
Gene Symbol
Pafah1b3
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IDA:RGD C cytosol
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0003847 IEA:UniProtKB-EC F 1-alkyl-2-acetylglycerophosphocholine esterase activity
GO:0047179 TAS:RGD F platelet-activating factor acetyltransferase activity
GO:0046982 IPI:RGD F protein heterodimerization activity
GO:0007420 IEP:RGD P brain development
GO:0016042 IEA:UniProtKB-KW P lipid catabolic process
GO:0007283 IEA:Ensembl P spermatogenesis

KEGG Pathway Links

KEGG Pathway ID Description
ko00565 Ether lipid metabolism
rno00565 Ether lipid metabolism
rno01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR013831 SGNH_hydro-type_esterase_dom

UniProt Annotations

Entry Information

Gene Name
platelet-activating factor acetylhydrolase 1b, catalytic subunit 3
Protein Entry
PA1B3_RAT
UniProt ID
O35263
Species
Rat

Comments

Comment Type Description
Catalytic Activity 1-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H(2)O = 1-alkyl-sn-glycero-3-phosphocholine + acetate.
Function Inactivates paf by removing the acetyl group at the sn-2 position. This is a catalytic subunit. Plays an important role during the development of brain.
Similarity Belongs to the 'GDSL' lipolytic enzyme family. Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily
Similarity Belongs to the 'GDSL' lipolytic enzyme family. Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily. {ECO:0000305}.
Subcellular Location Cytoplasm .
Subcellular Location Cytoplasm {ECO:0000250}.
Subunit Cytosolic PAF-AH IB is formed of three subunits of 45 kDa (alpha), 30 kDa (beta) and 29 kDa (gamma). The catalytic activity of the enzyme resides in the beta and gamma subunits, whereas the alpha subunit has regulatory activity. Trimer formation is not essential for the catalytic activity.
Tissue Specificity Expressed in brain, spleen, lung, liver, kidney and testis. Not expressed in heart and skeletal muscle.

Identical and Related Proteins

Unique RefSeq proteins for LMP012859 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16758470 RefSeq NP_446106 232 platelet-activating factor acetylhydrolase IB subunit gamma

Identical Sequences to LMP012859 proteins

Reference Database Accession Length Protein Name
GI:16758470 GenBank AAE64274.1 232 Sequence 38 from patent US 6146868
GI:16758470 GenBank EDM08032.1 232 platelet-activating factor acetylhydrolase, isoform 1b, alpha1 subunit, isoform CRA_a [Rattus norvegicus]
GI:16758470 GenBank AEU43481.1 232 Sequence 230 from patent US 8052970
GI:16758470 RefSeq XP_006228427.1 232 PREDICTED: platelet-activating factor acetylhydrolase IB subunit gamma isoform X1 [Rattus norvegicus]

Related Sequences to LMP012859 proteins

Reference Database Accession Length Protein Name
GI:16758470 GenBank AAC27973.1 232 platelet-activating factor acetylhydrolase alpha 1 subunit [Rattus norvegicus]
GI:16758470 GenBank EDM08032.1 232 platelet-activating factor acetylhydrolase, isoform 1b, alpha1 subunit, isoform CRA_a [Rattus norvegicus]
GI:16758470 SwissProt O35263.1 232 RecName: Full=Platelet-activating factor acetylhydrolase IB subunit gamma; AltName: Full=PAF acetylhydrolase 29 kDa subunit; Short=PAF-AH 29 kDa subunit; AltName: Full=PAF-AH subunit gamma; Short=PAFAH subunit gamma; AltName: Full=Platelet-activating factor acetylhydrolase alpha 1 subunit; Short=PAF-AH alpha 1 [Rattus norvegicus]