Gene/Proteome Database (LMPD)

LMPD ID
LMP012868
Gene ID
114700
Species
Rattus norvegicus (Rat)
Gene Name
cytochrome P450, family 27, subfamily b, polypeptide 1
Gene Symbol
Cyp27b1
Synonyms
Cyp40;
Alternate Names
25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial; P450C1 alpha; P450VD1-alpha; VD3 1A hydroxylase; cytochrome p450 27B1; cytochrome P450C1 alpha; cytochrome P450VD1-alpha; calcidiol 1-monooxygenase; 25-OHD-1 alpha-hydroxylase; 25-hydroxyvitamin D(3) 1-alpha-hydroxylase; cytochrome P450, subfamily 27b, polypeptide 1; cytochrome P450 subfamily XXVIIB polypeptide 1; cytochrome P450 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450, 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450 subfamily XXVIIB (25-hydroxyvitamin D-1-alpha-hydroxylase) polypeptide 1;
Chromosome
7
Map Location
chromosome:7
EC Number
1.14.13.13
Summary
cytochrome P450 enzyme that plays a role in vitamin D metabolism [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Cyp27b1

Proteins

25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
Refseq ID NP_446215
Protein GI 16758598
UniProt ID O35132
mRNA ID NM_053763
Length 501
MTQAVKLASRVFHRVQLPSQLGSDSVLRSLSDIPGPSTPSFLAELFCKGGLSRLHELQVHGAARYGPIWSGSFGTLRTVYVADPALVEQLLRQESHCPERCSFSSWSEHRRRHQRACGLLTADGEEWQRLRSLLAPLLLRPQAAAGYAGTLDSVVSDLVRRLRRQRGRGSGLPDLVLDVAGEFYKFGLEGIGAVLLGSRLGCLEAEVPPDTETFIEAVGSVFVSTLLTMAMPSWLHRLIPGPWARLCRDWDQMFAFAQKHVEQREGEAAVRNQGKPEEDLPTGHHLTHFLFREKVSVQSIVGNVTELLLAGVDTVSNTLSWALYELSRHPEVQSALHSEITGAVNPGSYAHLQATALSQLPLLKAVIKEVLRLYPVVPGNSRVPDRDICVGNYVIPQDTLVSLCHYATSRDPAQFREPNSFNPARWLGEGPAPHPFASLPFGFGKRSCIGRRLAELELQMALAQILTHFEVLPEPGALPVKPMTRTVLVPERSIHLQFVDR

Gene Information

Entrez Gene ID
114700
Gene Name
cytochrome P450, family 27, subfamily b, polypeptide 1
Gene Symbol
Cyp27b1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016020 IEA:UniProtKB-KW C membrane
GO:0005739 IDA:RGD C mitochondrion
GO:0004498 IDA:BHF-UCL F calcidiol 1-monooxygenase activity
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0007568 IDA:RGD P aging
GO:0036378 IDA:GOC P calcitriol biosynthetic process from calciol
GO:0007595 IEP:RGD P lactation
GO:0051591 IDA:RGD P response to cAMP
GO:0051592 IEP:RGD P response to calcium ion
GO:0046688 IDA:RGD P response to copper ion
GO:0042493 IDA:RGD P response to drug
GO:0032868 IDA:RGD P response to insulin
GO:0043434 IEP:RGD P response to peptide hormone
GO:0034695 IDA:RGD P response to prostaglandin E
GO:0033280 IDA:RGD P response to vitamin D
GO:0042369 IDA:BHF-UCL P vitamin D catabolic process
GO:0042359 IDA:RGD P vitamin D metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
M00103 Cholecalciferol biosynthesis
rno01100 Metabolic pathways
ko00100 Steroid biosynthesis
rno00100 Steroid biosynthesis
ko05152 Tuberculosis
rno05152 Tuberculosis

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-6076 1,25-dihydroxyvitamin D3 biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001128 Cytochrome P450
IPR002401 Cytochrome P450, E-class, group I
IPR017972 Cytochrome P450, conserved site

UniProt Annotations

Entry Information

Gene Name
cytochrome P450, family 27, subfamily b, polypeptide 1
Protein Entry
CP27B_RAT
UniProt ID
O35132
Species
Rat

Comments

Comment Type Description
Catalytic Activity Calcidiol + NADPH + O(2) = calcitriol + NADP(+) + H(2)O.
Cofactor Name=heme; Xref=ChEBI:CHEBI:30413; Evidence= ;
Function Catalyzes the conversion of 25-hydroxyvitamin D3 (25(OH)D) to 1-alpha,25-dihydroxyvitamin D3 (1,25(OH)2D) plays an important role in normal bone growth, calcium metabolism, and tissue differentiation.
Pathway Hormone biosynthesis; cholecalciferol biosynthesis.
Similarity Belongs to the cytochrome P450 family
Subcellular Location Mitochondrion membrane.
Tissue Specificity Kidney.

Identical and Related Proteins

Unique RefSeq proteins for LMP012868 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16758598 RefSeq NP_446215 501 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial

Identical Sequences to LMP012868 proteins

Reference Database Accession Length Protein Name
GI:16758598 EMBL CAC39904.1 501 unnamed protein product, partial [Rattus norvegicus]
GI:16758598 EMBL CAC39906.1 501 unnamed protein product [Rattus norvegicus]
GI:16758598 GenBank AAE79370.1 501 Sequence 1 from patent US 6274359
GI:16758598 SwissProt O35132.2 501 RecName: Full=25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial; AltName: Full=25-OHD-1 alpha-hydroxylase; AltName: Full=25-hydroxyvitamin D(3) 1-alpha-hydroxylase; Short=VD3 1A hydroxylase; AltName: Full=Calcidiol 1-monooxygenase; AltName: Full=Cytochrome P450 subfamily XXVIIB polypeptide 1; AltName: Full=Cytochrome P450C1 alpha; AltName: Full=Cytochrome P450VD1-alpha; AltName: Full=Cytochrome p450 27B1; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP012868 proteins

Reference Database Accession Length Protein Name
GI:16758598 DBBJ BAA23271.1 501 VD3 1a hydroxylase [Rattus norvegicus]
GI:16758598 EMBL CAC39904.1 501 unnamed protein product, partial [Rattus norvegicus]
GI:16758598 SwissProt O35132.2 501 RecName: Full=25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial; AltName: Full=25-OHD-1 alpha-hydroxylase; AltName: Full=25-hydroxyvitamin D(3) 1-alpha-hydroxylase; Short=VD3 1A hydroxylase; AltName: Full=Calcidiol 1-monooxygenase; AltName: Full=Cytochrome P450 subfamily XXVIIB polypeptide 1; AltName: Full=Cytochrome P450C1 alpha; AltName: Full=Cytochrome P450VD1-alpha; AltName: Full=Cytochrome p450 27B1; Flags: Precursor [Rattus norvegicus]