Gene/Proteome Database (LMPD)
LMPD ID
LMP012869
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
prohibitin 2
Gene Symbol
Synonyms
Bap; Bap37; Bap-37; Bcap27; Bcap37;
Alternate Names
prohibitin-2; phb2 {ECO:0000250|UniProtKB:Q99623}; B-cell receptor associated protein 37; B-cell receptor-associated protein 37; B-cell receptor-associated protein BAP37;
Chromosome
4
Map Location
4q42
Proteins
| prohibitin-2 | |
|---|---|
| Refseq ID | NP_001013053 |
| Protein GI | 61556754 |
| UniProt ID | Q5XIH7 |
| mRNA ID | NM_001013035 |
| Length | 299 |
| MAQNLKDLAGRLPSGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0005743 | ISS:UniProtKB | C | mitochondrial inner membrane |
| GO:0016363 | ISS:UniProtKB | C | nuclear matrix |
| GO:0005634 | ISS:UniProtKB | C | nucleus |
| GO:0043234 | ISS:UniProtKB | C | protein complex |
| GO:0060749 | IEA:Ensembl | P | mammary gland alveolus development |
| GO:0060744 | IEA:Ensembl | P | mammary gland branching involved in thelarche |
| GO:0033147 | IEA:Ensembl | P | negative regulation of intracellular estrogen receptor signaling pathway |
| GO:0033600 | IEA:Ensembl | P | negative regulation of mammary gland epithelial cell proliferation |
| GO:0045892 | ISS:UniProtKB | P | negative regulation of transcription, DNA-templated |
| GO:0060762 | IEA:Ensembl | P | regulation of branching involved in mammary gland duct morphogenesis |
| GO:0006351 | IEA:UniProtKB-KW | P | transcription, DNA-templated |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. Functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. Competes with NCOA1 for modulation of ER transcriptional activity. Probably involved in regulating mitochondrial respiration activity and in aging (By similarity). {ECO:0000250|UniProtKB:O35129, ECO:0000250|UniProtKB:Q99623}. |
| Similarity | Belongs to the prohibitin family |
| Subcellular Location | Mitochondrion inner membrane . Cytoplasm . Nucleus . Note=Also cytoplasmic and nuclear. |
| Subunit | Interacts with PHB, ESR1, HDAC1 and HDAC5. Interacts with ZNF703. Interacts with STOML2 (By similarity) |
Identical and Related Proteins
Unique RefSeq proteins for LMP012869 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 61556754 | RefSeq | NP_001013053 | 299 | prohibitin-2 |
Identical Sequences to LMP012869 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:61556754 | GenBank | AAH83705.1 | 299 | Prohibitin 2 [Rattus norvegicus] |
| GI:61556754 | SwissProt | Q5XIH7.1 | 299 | RecName: Full=Prohibitin-2; AltName: Full=B-cell receptor-associated protein BAP37; Short=BAP-37 [Rattus norvegicus] |
Related Sequences to LMP012869 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:61556754 | GenBank | AAH83705.1 | 299 | Prohibitin 2 [Rattus norvegicus] |
| GI:61556754 | RefSeq | XP_004596457.1 | 299 | PREDICTED: prohibitin-2 isoform X1 [Ochotona princeps] |
| GI:61556754 | SwissProt | Q5XIH7.1 | 299 | RecName: Full=Prohibitin-2; AltName: Full=B-cell receptor-associated protein BAP37; Short=BAP-37 [Rattus norvegicus] |