Gene/Proteome Database (LMPD)
LMPD ID
LMP012870
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
aldo-keto reductase family 1, member B7
Gene Symbol
Synonyms
Avdp; MVDP; Akr1b14;
Alternate Names
aldose reductase-related protein 1; aldehyde reductase; aldose reductase-like protein AKR1B14; androgen regulated vas deferens protein;
Chromosome
4
Map Location
4q22
EC Number
1.1.1.21
Proteins
| aldose reductase-related protein 1 | |
|---|---|
| Refseq ID | NP_446233 |
| Protein GI | 148540194 |
| UniProt ID | Q5RJP0 |
| mRNA ID | NM_053781 |
| Length | 316 |
| MTTFVKLRTKAKMPLVGLGTWKSPPGQVKEAVKAAIDAGYRHFDCAYVYQNESEVGEAIQEKIKEKAVRREDLFIVSKLWSTFFEKSLMKEAFQKTLSDLKLDYLDLYLIHWPQGLQAGKEFLPKDSQGKVLMSKSTFLDAWEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGIAVIAYSPLGSPDRPYAKPEDPVVLEIPKIKEIAAKHKKTIAQVLIRFHVQRNVAVIPKSVTLSHIKENIQVFDFQLSEEDMAAILSLNRNWRACGLFVTSDEEDFPFHEEY | |
Gene Information
Entrez Gene ID
Gene Name
aldo-keto reductase family 1, member B7
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005739 | IEA:Ensembl | C | mitochondrion |
| GO:0004032 | TAS:RGD | F | alditol:NADP+ 1-oxidoreductase activity |
| GO:0004033 | TAS:RGD | F | aldo-keto reductase (NADP) activity |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00051 | Fructose and mannose metabolism |
| rno00051 | Fructose and mannose metabolism |
| ko00052 | Galactose metabolism |
| rno00052 | Galactose metabolism |
| ko00561 | Glycerolipid metabolism |
| rno00561 | Glycerolipid metabolism |
| rno01100 | Metabolic pathways |
| ko00040 | Pentose and glucuronate interconversions |
| rno00040 | Pentose and glucuronate interconversions |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
aldo-keto reductase family 1, member B7
Protein Entry
ALD1_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=1.5 uM for NADPH {ECO:0000269|PubMed:21048316, ECO:0000269|PubMed:21168333}; KM=220 uM for NADH {ECO:0000269|PubMed:21048316, ECO:0000269|PubMed:21168333}; KM=0.16 uM for 4-oxo-2-nonenal {ECO:0000269|PubMed:21048316, ECO:0000269|PubMed:21168333}; KM=37 uM for geraniol {ECO:0000269|PubMed:21048316, ECO:0000269|PubMed:21168333}; KM=1.5 uM for 4-nitrobenzaldehyde {ECO:0000269|PubMed:21048316, ECO:0000269|PubMed:21168333}; pH dependence: Optimum pH is 6.5-7. {ECO:0000269|PubMed:21048316, ECO:0000269|PubMed:21168333}; |
| Catalytic Activity | Alditol + NAD(P)(+) = aldose + NAD(P)H |
| Enzyme Regulation | Inhibited by tolrestat and epalrestat |
| Function | Reduces a broad range of aliphatic and aromatic aldehydes to the corresponding alcohols. May play a role in the metabolism of xenobiotic aromatic aldehydes |
| Similarity | Belongs to the aldo/keto reductase family |
| Subcellular Location | Cytoplasm . |
| Subunit | Monomer |
Identical and Related Proteins
Unique RefSeq proteins for LMP012870 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 148540194 | RefSeq | NP_446233 | 316 | aldose reductase-related protein 1 |
Identical Sequences to LMP012870 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:148540194 | GenBank | EDM15308.1 | 316 | rCG28223, isoform CRA_a [Rattus norvegicus] |
| GI:148540194 | PDB | 3O3R | 316 | Chain A, Crystal Structure Of Akr1b14 In Complex With Nadp |
| GI:148540194 | PDB | 3O3R | 316 | Chain B, Crystal Structure Of Akr1b14 In Complex With Nadp |
| GI:148540194 | SwissProt | Q5RJP0.1 | 316 | RecName: Full=Aldose reductase-related protein 1; AltName: Full=Aldehyde reductase; AltName: Full=Aldo-keto reductase family 1 member B7; AltName: Full=Aldose reductase-like protein AKR1B14 [Rattus norvegicus] |