Gene/Proteome Database (LMPD)

LMPD ID
LMP012883
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
peroxisomal biogenesis factor 12
Gene Symbol
Alternate Names
peroxisome assembly protein 12; PAF-3; peroxin-12; peroxisome assembly factor 3;
Chromosome
10
Map Location
10q26
Summary
required for peroxisome biogenesis; functionally complements the mutation in fibroblasts from patients with Zellweger syndrome of complementation group III [RGD, Feb 2006]
Orthologs

Proteins

peroxisome assembly protein 12
Refseq ID NP_446373
Protein GI 16758802
UniProt ID O88177
mRNA ID NM_053921
Length 359
MAEHGAHITTASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPAHYGFFWRWFDEIFTLLDFLLQQHYLSRTSASFSEHFYGLKRIVAGSSPQLQRPASAGLPKEHLWKSAMFLVLLPYLKVKLEKLASTLREEDEYSIHPPSSHWKRFYRVFLAAYPFVTMTWEGWFLTQQLRYILGKAEHHSPLLKLAGVRLGRLTAQDIQAMEHRLVEASAMQEPVRSIGKKIKSALKKAVGGVALSLSTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKMKTVCPLCRKARVNDTVLATSGYVFCYRCVFNYVRSHQACPITGYPTEVQHLIKLYSPEN

Gene Information

Entrez Gene ID
Gene Name
peroxisomal biogenesis factor 12
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005779 IEA:InterPro C integral component of peroxisomal membrane
GO:0005778 IDA:HGNC C peroxisomal membrane
GO:0005777 IDA:RGD C peroxisome
GO:0008270 IEA:InterPro F zinc ion binding
GO:0007031 IMP:RGD P peroxisome organization
GO:0006625 IEA:InterPro P protein targeting to peroxisome

KEGG Pathway Links

KEGG Pathway ID Description
ko04146 Peroxisome
rno04146 Peroxisome

Domain Information

InterPro Annotations

Accession Description
IPR017375 Peroxisome assembly protein 12
IPR006845 Pex, N-terminal
IPR001841 Zinc finger, RING-type
IPR013083 Zinc finger, RING/FYVE/PHD-type

UniProt Annotations

Entry Information

Gene Name
peroxisomal biogenesis factor 12
Protein Entry
PEX12_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Function Required for protein import into peroxisomes.
Similarity Belongs to the pex2/pex10/pex12 family
Similarity Contains 1 RING-type zinc finger
Subcellular Location Peroxisome membrane; Multi-pass membrane protein.
Subunit Interacts with PEX5 and PEX10. Interacts with PEX19 via its cytoplasmic domain (By similarity)

Identical and Related Proteins

Unique RefSeq proteins for LMP012883 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16758802 RefSeq NP_446373 359 peroxisome assembly protein 12

Identical Sequences to LMP012883 proteins

Reference Database Accession Length Protein Name
GI:16758802 RefSeq XP_006247029.1 359 PREDICTED: peroxisome assembly protein 12 isoform X1 [Rattus norvegicus]
GI:16758802 RefSeq XP_006247088.1 359 PREDICTED: peroxisome assembly protein 12 [Rattus norvegicus]
GI:16758802 RefSeq XP_008766156.1 359 PREDICTED: peroxisome assembly protein 12 isoform X1 [Rattus norvegicus]
GI:16758802 RefSeq XP_008772090.1 359 PREDICTED: peroxisome assembly protein 12 [Rattus norvegicus]

Related Sequences to LMP012883 proteins

Reference Database Accession Length Protein Name
GI:16758802 GenBank AAH72481.1 359 Peroxisomal biogenesis factor 12 [Rattus norvegicus]
GI:16758802 RefSeq XP_008766156.1 359 PREDICTED: peroxisome assembly protein 12 isoform X1 [Rattus norvegicus]
GI:16758802 RefSeq XP_008772090.1 359 PREDICTED: peroxisome assembly protein 12 [Rattus norvegicus]