Gene/Proteome Database (LMPD)

LMPD ID
LMP012888
Gene ID
116744
Species
Rattus norvegicus (Rat)
Gene Name
lysophosphatidic acid receptor 1
Gene Symbol
Lpar1
Synonyms
Edg2;
Alternate Names
lysophosphatidic acid receptor 1; LPA-1; LPA receptor 1; lysophosphatidic acid receptor Edg-2; endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, 2;
Chromosome
5
Map Location
5q24
Summary
G-protein coupled receptor for lysophosphatidic acid (LPA); may mediate LPA induced increase in intracellular calcium ion concentration [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Lpar1

Proteins

lysophosphatidic acid receptor 1
Refseq ID NP_446388
Protein GI 16758816
UniProt ID P61794
mRNA ID NM_053936
Length 364
MAAASTSSPVISQPQFTAMNEQQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVCVFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIDHCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMSRHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCDVLAYEKFFLLLAEFNSAMNPIIYSYRDKEMSATFRQILCCQRNENPNGPTEGSDRSASSLNHTILAGVHSNDHSVV

Gene Information

Entrez Gene ID
116744
Gene Name
lysophosphatidic acid receptor 1
Gene Symbol
Lpar1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009986 ISS:UniProtKB C cell surface
GO:0005737 IDA:RGD C cytoplasm
GO:0043198 IDA:RGD C dendritic shaft
GO:0043197 IDA:RGD C dendritic spine
GO:0030139 IEA:Ensembl C endocytic vesicle
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IDA:RGD C plasma membrane
GO:0001965 IMP:RGD F G-protein alpha-subunit binding
GO:0004930 TAS:RGD F G-protein coupled receptor activity
GO:0070915 IEA:InterPro F lysophosphatidic acid receptor activity
GO:0005543 IDA:RGD F phospholipid binding
GO:0007186 IMP:RGD P G-protein coupled receptor signaling pathway
GO:0000187 IEA:Ensembl P activation of MAPK activity
GO:0032060 IEA:Ensembl P bleb assembly
GO:0071453 IEP:RGD P cellular response to oxygen levels
GO:0042552 IEP:RGD P myelination
GO:0010977 IMP:RGD P negative regulation of neuron projection development
GO:0022008 IEP:RGD P neurogenesis
GO:0043123 IEA:Ensembl P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0035025 IEA:Ensembl P positive regulation of Rho protein signal transduction
GO:0043065 IMP:RGD P positive regulation of apoptotic process
GO:0010942 IMP:RGD P positive regulation of cell death
GO:0051482 IDA:RGD P positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway
GO:0060999 IDA:RGD P positive regulation of dendritic spine development
GO:0071673 IMP:RGD P positive regulation of smooth muscle cell chemotaxis

KEGG Pathway Links

KEGG Pathway ID Description
ko04540 Gap junction
rno04540 Gap junction
ko04080 Neuroactive ligand-receptor interaction
rno04080 Neuroactive ligand-receptor interaction
ko04151 PI3K-Akt signaling pathway
rno04151 PI3K-Akt signaling pathway
ko04015 Rap1 signaling pathway
rno04015 Rap1 signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5954122 Class A/1 (Rhodopsin-like receptors)
5954152 G alpha (i) signalling events
5953653 G alpha (q) signalling events
5953642 GPCR downstream signaling
5953758 GPCR ligand binding
5953537 Gastrin-CREB signalling pathway via PKC and MAPK
5954244 Lysosphingolipid and LPA receptors
5953381 Signal Transduction
5953391 Signaling by GPCR

Domain Information

InterPro Annotations

Accession Description
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM
IPR004065 Lysophosphatidic acid receptor
IPR002277 Lysophosphatidic acid receptor EDG-2

UniProt Annotations

Entry Information

Gene Name
lysophosphatidic acid receptor 1
Protein Entry
LPAR1_RAT
UniProt ID
P61794
Species
Rat

Comments

Comment Type Description
Function Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Seems to be coupled to the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins. Stimulates phospholipase C (PLC) activity in a manner that is dependent on RALA activation (By similarity)
Similarity Belongs to the G-protein coupled receptor 1 family
Subcellular Location Cell surface . Cell membrane; Multi-pass membrane protein. Note=Prior to LPA treatment found predominantly at the cell surface but in the presence of LPA co- localizes with RALA in the endocytic vesicles
Subunit Interacts with RALA and ADRBK1

Identical and Related Proteins

Unique RefSeq proteins for LMP012888 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16758816 RefSeq NP_446388 364 lysophosphatidic acid receptor 1

Identical Sequences to LMP012888 proteins

Reference Database Accession Length Protein Name
GI:16758816 RefSeq XP_006238259.1 364 PREDICTED: lysophosphatidic acid receptor 1 isoform X1 [Rattus norvegicus]
GI:16758816 RefSeq XP_006238262.1 364 PREDICTED: lysophosphatidic acid receptor 1 isoform X1 [Rattus norvegicus]
GI:16758816 RefSeq XP_006238263.1 364 PREDICTED: lysophosphatidic acid receptor 1 isoform X1 [Rattus norvegicus]
GI:16758816 RefSeq XP_008761954.1 364 PREDICTED: lysophosphatidic acid receptor 1 isoform X1 [Rattus norvegicus]

Related Sequences to LMP012888 proteins

Reference Database Accession Length Protein Name
GI:16758816 GenBank AAH25425.1 364 Lpar1 protein [Mus musculus]
GI:16758816 RefSeq XP_008761954.1 364 PREDICTED: lysophosphatidic acid receptor 1 isoform X1 [Rattus norvegicus]
GI:16758816 SwissProt P61794.1 364 RecName: Full=Lysophosphatidic acid receptor 1; Short=LPA receptor 1; Short=LPA-1; AltName: Full=Lysophosphatidic acid receptor Edg-2 [Rattus norvegicus]