Gene/Proteome Database (LMPD)
LMPD ID
LMP012895
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
emopamil binding protein (sterol isomerase)
Gene Symbol
Alternate Names
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase; sterol 8-isomerase; D8-D7 sterol isomerase; emopamil-binding protein; cholestenol Delta-isomerase; delta(8)-Delta(7) sterol isomerase; phenylalkylamine Ca2+ antagonist (emopamil) binding protein;
Chromosome
X
Map Location
Xq13
EC Number
5.3.3.5
Summary
catalyses the conversion of 5-alpha-cholest-8-en-3-beta-ol to 5-alpha-cholest-7-en-3-beta-ol in cholesterol biosynthesis [RGD, Feb 2006]
Orthologs
Proteins
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase | |
---|---|
Refseq ID | NP_476478 |
Protein GI | 16923992 |
UniProt ID | Q9JJ46 |
mRNA ID | NM_057137 |
Length | 230 |
MTTNMLPLHPYWPRHLRLDNFVPNDLPTWHILVGLFSFSGVLIVITWLLSSRVSVVPLGTGRRLALCWFAVCTFIHLVIEGWFSFYHEILLEDQAFLSQLWKEYSKGDSRYILSDGFIVCMESVTACLWGPLSLWVVIAFLRHQPFRFVLQLVVSVGQIYGDVLYFLTELRDGFQHGELGHPLYFWFYFVIMNAIWLVIPGILVFDAIKHLTNAQSMLDNKVMKIKSKHN |
Gene Information
Entrez Gene ID
Gene Name
emopamil binding protein (sterol isomerase)
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0043231 | IDA:RGD | C | intracellular membrane-bounded organelle |
GO:0000247 | IDA:RGD | F | C-8 sterol isomerase activity |
GO:0047750 | IEA:UniProtKB-EC | F | cholestenol delta-isomerase activity |
GO:0006695 | IDA:RGD | P | cholesterol biosynthetic process |
GO:0030097 | IEA:Ensembl | P | hemopoiesis |
GO:0016126 | TAS:RGD | P | sterol biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
M00101 | Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol |
rno01100 | Metabolic pathways |
ko00100 | Steroid biosynthesis |
rno00100 | Steroid biosynthesis |
REACTOME Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR007905 | Emopamil-binding protein |
UniProt Annotations
Entry Information
Gene Name
emopamil binding protein (sterol isomerase)
Protein Entry
EBP_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Catalytic Activity | 5-alpha-cholest-7-en-3-beta-ol = 5-alpha- cholest-8-en-3-beta-ol. |
Function | Catalyzes the conversion of Delta(8)-sterols to their corresponding Delta(7)-isomers |
Miscellaneous | Binds to the phenylalkylamine calcium-ion antagonist emopamil, an anti-ischemic drug. |
Pathway | Steroid biosynthesis; cholesterol biosynthesis. |
Similarity | Belongs to the EBP family |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP012895 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
16923992 | RefSeq | NP_476478 | 230 | 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase |
Identical Sequences to LMP012895 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16923992 | GenBank | AAQ14592.1 | 230 | sterol 8-isomerase [Rattus norvegicus] |
GI:16923992 | GenBank | EDL83791.1 | 230 | phenylalkylamine Ca2+ antagonist (emopamil) binding protein, isoform CRA_b [Rattus norvegicus] |
GI:16923992 | GenBank | EDL83792.1 | 230 | phenylalkylamine Ca2+ antagonist (emopamil) binding protein, isoform CRA_b [Rattus norvegicus] |
GI:16923992 | RefSeq | XP_006256761.1 | 230 | PREDICTED: 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase isoform X1 [Rattus norvegicus] |
Related Sequences to LMP012895 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16923992 | GenBank | AAF74807.1 | 230 | sterol delta 8-isomerase [Rattus norvegicus] |
GI:16923992 | GenBank | EDL83791.1 | 230 | phenylalkylamine Ca2+ antagonist (emopamil) binding protein, isoform CRA_b [Rattus norvegicus] |
GI:16923992 | RefSeq | XP_006256761.1 | 230 | PREDICTED: 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase isoform X1 [Rattus norvegicus] |