Gene/Proteome Database (LMPD)

LMPD ID
LMP012895
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
emopamil binding protein (sterol isomerase)
Gene Symbol
Alternate Names
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase; sterol 8-isomerase; D8-D7 sterol isomerase; emopamil-binding protein; cholestenol Delta-isomerase; delta(8)-Delta(7) sterol isomerase; phenylalkylamine Ca2+ antagonist (emopamil) binding protein;
Chromosome
X
Map Location
Xq13
EC Number
5.3.3.5
Summary
catalyses the conversion of 5-alpha-cholest-8-en-3-beta-ol to 5-alpha-cholest-7-en-3-beta-ol in cholesterol biosynthesis [RGD, Feb 2006]
Orthologs

Proteins

3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase
Refseq ID NP_476478
Protein GI 16923992
UniProt ID Q9JJ46
mRNA ID NM_057137
Length 230
MTTNMLPLHPYWPRHLRLDNFVPNDLPTWHILVGLFSFSGVLIVITWLLSSRVSVVPLGTGRRLALCWFAVCTFIHLVIEGWFSFYHEILLEDQAFLSQLWKEYSKGDSRYILSDGFIVCMESVTACLWGPLSLWVVIAFLRHQPFRFVLQLVVSVGQIYGDVLYFLTELRDGFQHGELGHPLYFWFYFVIMNAIWLVIPGILVFDAIKHLTNAQSMLDNKVMKIKSKHN

Gene Information

Entrez Gene ID
Gene Name
emopamil binding protein (sterol isomerase)
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0043231 IDA:RGD C intracellular membrane-bounded organelle
GO:0000247 IDA:RGD F C-8 sterol isomerase activity
GO:0047750 IEA:UniProtKB-EC F cholestenol delta-isomerase activity
GO:0006695 IDA:RGD P cholesterol biosynthetic process
GO:0030097 IEA:Ensembl P hemopoiesis
GO:0016126 TAS:RGD P sterol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
M00101 Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
rno01100 Metabolic pathways
ko00100 Steroid biosynthesis
rno00100 Steroid biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953924 Cholesterol biosynthesis
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins

Domain Information

InterPro Annotations

Accession Description
IPR007905 Emopamil-binding protein

UniProt Annotations

Entry Information

Gene Name
emopamil binding protein (sterol isomerase)
Protein Entry
EBP_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity 5-alpha-cholest-7-en-3-beta-ol = 5-alpha- cholest-8-en-3-beta-ol.
Function Catalyzes the conversion of Delta(8)-sterols to their corresponding Delta(7)-isomers
Miscellaneous Binds to the phenylalkylamine calcium-ion antagonist emopamil, an anti-ischemic drug.
Pathway Steroid biosynthesis; cholesterol biosynthesis.
Similarity Belongs to the EBP family
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein .

Identical and Related Proteins

Unique RefSeq proteins for LMP012895 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16923992 RefSeq NP_476478 230 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase

Identical Sequences to LMP012895 proteins

Reference Database Accession Length Protein Name
GI:16923992 GenBank AAQ14592.1 230 sterol 8-isomerase [Rattus norvegicus]
GI:16923992 GenBank EDL83791.1 230 phenylalkylamine Ca2+ antagonist (emopamil) binding protein, isoform CRA_b [Rattus norvegicus]
GI:16923992 GenBank EDL83792.1 230 phenylalkylamine Ca2+ antagonist (emopamil) binding protein, isoform CRA_b [Rattus norvegicus]
GI:16923992 RefSeq XP_006256761.1 230 PREDICTED: 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase isoform X1 [Rattus norvegicus]

Related Sequences to LMP012895 proteins

Reference Database Accession Length Protein Name
GI:16923992 GenBank AAF74807.1 230 sterol delta 8-isomerase [Rattus norvegicus]
GI:16923992 GenBank EDL83791.1 230 phenylalkylamine Ca2+ antagonist (emopamil) binding protein, isoform CRA_b [Rattus norvegicus]
GI:16923992 RefSeq XP_006256761.1 230 PREDICTED: 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase isoform X1 [Rattus norvegicus]