Gene/Proteome Database (LMPD)
LMPD ID
LMP012910
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
methylsterol monooxygenase 1
Gene Symbol
Synonyms
Sc4mol;
Alternate Names
methylsterol monooxygenase 1; RANP-1; neuropep 1; neurorep 1; C-4 methylsterol oxidase;
Chromosome
16
Map Location
16p13
EC Number
1.14.13.72
Summary
may be involved in the repair process of nerve tissues [RGD, Feb 2006]
Orthologs
Proteins
| methylsterol monooxygenase 1 | |
|---|---|
| Refseq ID | NP_543162 |
| Protein GI | 18266684 |
| UniProt ID | O35532 |
| mRNA ID | NM_080886 |
| Length | 293 |
| MAMNKSVGLFSSASLAVDYVDSLLPENPLQEPFKNAWVYMLDNYTKFQIATWGSLIVHETIYFLFSLPGFLFQFIPFMRKYKIQKDKPETFEGQWKCLKGILFNHFFIQLPLICGTYYFTEFFNIPYDWERMPRWYFTLARCLGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPFGIEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTMRLLETIDVHSGYDIPLNPLNYIPFYTGARHHDFHHMNFIGNYASTFTWWDRIFGTDVQYHAYTEKMKKLGKKSE | |
Gene Information
Entrez Gene ID
Gene Name
methylsterol monooxygenase 1
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0000254 | IEA:UniProtKB-EC | F | C-4 methylsterol oxidase activity |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
| GO:0016126 | IEA:UniProtKB-KW | P | sterol biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| M00101 | Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol |
| rno01100 | Metabolic pathways |
| ko00100 | Steroid biosynthesis |
| rno00100 | Steroid biosynthesis |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 3-beta-hydroxy-4-beta-methyl-5-alpha-cholest- 7-ene-4-alpha-carbaldehyde + NAD(P)H + O(2) = 3-beta-hydroxy-4- beta-methyl-5-alpha-cholest-7-ene-4-alpha-carboxylate + NAD(P)(+) + H(2)O. |
| Catalytic Activity | 4,4-dimethyl-5-alpha-cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + NAD(P)(+) + H(2)O. |
| Catalytic Activity | 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 3-beta-hydroxy-4-beta- methyl-5-alpha-cholest-7-ene-4-alpha-carbaldehyde + NAD(P)(+) + 2 H(2)O. |
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence= ; |
| Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. |
| Pathway | Steroid biosynthesis; zymosterol biosynthesis; zymosterol from lanosterol: step 3/6. |
| Similarity | Belongs to the sterol desaturase family |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP012910 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18266684 | RefSeq | NP_543162 | 293 | methylsterol monooxygenase 1 |
Identical Sequences to LMP012910 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18266684 | EMBL | CAR81352.1 | 293 | unnamed protein product [Rattus norvegicus] |
| GI:18266684 | EMBL | CBX84828.1 | 293 | unnamed protein product [Rattus norvegicus] |
| GI:18266684 | GenBank | AAH63155.1 | 293 | Sterol-C4-methyl oxidase-like [Rattus norvegicus] |
| GI:18266684 | GenBank | EDL75983.1 | 293 | sterol-C4-methyl oxidase-like, isoform CRA_a [Rattus norvegicus] |
Related Sequences to LMP012910 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18266684 | EMBL | CBX84828.1 | 293 | unnamed protein product [Rattus norvegicus] |
| GI:18266684 | GenBank | EDL75983.1 | 293 | sterol-C4-methyl oxidase-like, isoform CRA_a [Rattus norvegicus] |
| GI:18266684 | SwissProt | O35532.1 | 293 | RecName: Full=Methylsterol monooxygenase 1; AltName: Full=C-4 methylsterol oxidase; AltName: Full=Neuropep 1; AltName: Full=RANP-1 [Rattus norvegicus] |