Gene/Proteome Database (LMPD)
LMPD ID
LMP012911
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
oxidized low density lipoprotein (lectin-like) receptor 1
Gene Symbol
Synonyms
LOX-1; Oldr1; Oldlr1;
Alternate Names
oxidized low-density lipoprotein receptor 1; ox-LDL receptor 1; lectin-like oxLDL receptor 1; lectin-like oxidized LDL receptor 1; lectin-type oxidized LDL receptor 1; lectin-like oxidized low-density lipoprotein receptor; Lectin-like oxidized low-density lipoprotein receptor-1; oxidised low density lipoprotein (lectin-like) receptor 1;
Chromosome
4
Map Location
4q42
Summary
receptor for oxidized low-density lipoprotein that may be involved in pathogenesis of hypertension as well as atherosclerosis [RGD, Feb 2006]
Orthologs
Proteins
| oxidized low-density lipoprotein receptor 1 | |
|---|---|
| Refseq ID | NP_579840 |
| Protein GI | 404247470 |
| UniProt ID | O70156 |
| mRNA ID | NM_133306 |
| Length | 368 |
| MNLEMAFDDKMKPVNGQPDQKSCGKKPKGLHLLSSTWWCPAAVTLAILCLVLSVTLIVQQTQLLQVSDLLKQYQANLTQQDHILEGQMSAQKKAENASQESKRELKEQIDTLTWKLNEKSKEQEKLLQQNQNLQEALQRAVNASEESKWELKEQIDILNWKLNGISKEQKELLQQNQNLQEALQKAEKYSEESQRELKEQIDTLSWKLNEKSKEQEELLQQNQNLQEALQRAANSSGPCPQDWIWHKENCYLFHGPFNWEKSRENCLSLDAQLLQISTTDDLNFVLQATSHSTSPFWMGLHRKNPNHPWLWENGSPLSFQFFRTRGVSLQMYSSGTCAYIQGGVVFAENCILTAFSICQKKANLLLTQ | |
Gene Information
Entrez Gene ID
Gene Name
oxidized low density lipoprotein (lectin-like) receptor 1
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005634 | IEA:Ensembl | C | nucleus |
| GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
| GO:0043235 | IEA:Ensembl | C | receptor complex |
| GO:0030246 | IEA:UniProtKB-KW | F | carbohydrate binding |
| GO:0005041 | TAS:RGD | F | low-density lipoprotein receptor activity |
| GO:0004872 | TAS:RGD | F | receptor activity |
| GO:0008219 | IMP:RGD | P | cell death |
| GO:0002376 | IEA:UniProtKB-KW | P | immune system process |
| GO:0006954 | IMP:RGD | P | inflammatory response |
| GO:0007159 | IMP:RGD | P | leukocyte cell-cell adhesion |
| GO:0042157 | IMP:RGD | P | lipoprotein metabolic process |
| GO:0042542 | IEP:RGD | P | response to hydrogen peroxide |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko03320 | PPAR signaling pathway |
| rno03320 | PPAR signaling pathway |
| ko04145 | Phagosome |
| rno04145 | Phagosome |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
oxidized low density lipoprotein (lectin-like) receptor 1
Protein Entry
OLR1_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Domain | The C-type lectin domain mediates the recognition and binding of oxLDL |
| Domain | The Neck region contains 3 internal repeats that are only found in rodents. |
| Domain | The cytoplasmic region is required for subcellular sorting on the cell surface |
| Function | Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro- oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro- atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram- positive bacteria. {ECO:0000269|PubMed:12538855, ECO:0000269|PubMed:9837956}. |
| Induction | By hypertension. Up-regulated by shear stress, lipopolysaccharide and TNF-alpha in cultured vascular endothelial cells |
| Ptm | N-glycosylated |
| Similarity | Contains 1 C-type lectin domain. {ECO:0000255|PROSITE- ProRule:PRU00040}. |
| Subcellular Location | Cell membrane ; Lipid-anchor {ECO:0000250}. Cell membrane ; Single-pass type II membrane protein {ECO:0000250}. Membrane raft . Secreted . Note=A secreted form also exists. Localization to membrane rafts requires palmitoylation (By similarity) |
| Subunit | Homodimer; disulfide-linked. May form a hexamer composed of 3 homodimers. Interacts with HSP70 (By similarity) |
| Tissue Specificity | Predominantly expressed in lung and at lower level in kidney. Expressed in macrophages but not in vascular smooth muscle cells |
Identical and Related Proteins
Unique RefSeq proteins for LMP012911 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 404247470 | RefSeq | NP_579840 | 368 | oxidized low-density lipoprotein receptor 1 |
Identical Sequences to LMP012911 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:404247470 | GenBank | EDM01737.1 | 368 | oxidized low density lipoprotein (lectin-like) receptor 1, isoform CRA_a [Rattus norvegicus] |
Related Sequences to LMP012911 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:404247470 | DBBJ | BAA35123.1 | 364 | lectin-like oxidized low-density lipoprotein receptor [Rattus norvegicus] |
| GI:404247470 | GenBank | EDM01737.1 | 368 | oxidized low density lipoprotein (lectin-like) receptor 1, isoform CRA_a [Rattus norvegicus] |
| GI:404247470 | GenBank | AEN26395.1 | 364 | Sequence 15 from patent US 7993643 |