Gene/Proteome Database (LMPD)
LMPD ID
LMP012930
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
cysteinyl leukotriene receptor 2
Gene Symbol
Synonyms
Cyslt2;
Alternate Names
cysteinyl leukotriene receptor 2; RSBPT32; cysteinyl leukotriene CysLT2 receptor;
Chromosome
15
Map Location
15p11
Summary
putative cysteinyl leukotriene receptor [RGD, Feb 2006]
Orthologs
Proteins
cysteinyl leukotriene receptor 2 | |
---|---|
Refseq ID | NP_596904 |
Protein GI | 19173778 |
UniProt ID | Q924T9 |
mRNA ID | NM_133413 |
Length | 309 |
MGVTGTPSYYSDKNCTIENFKRDFYPIIYLIIFVWGALGNGFSIYVFLQTYKKSTSVNVFMLNLAISDFLFISTLPFRADYNFRGSDWIFGDWACRIMSYSLYVNMYTSIYFLTVLSIVRFLATAHPFQMLHITSVRSAWILCGIIWVFIMASSGLLLKHGQEKKNNTTLCFELNLQKFKNLVILNYIALGVGFLLPFFILTICYLLIIRVLLKVEIPESGPRDAQRKALTTIVIAMIIFLLCFLPYHALRTIHLVTWDADSCMDELHKATVITLTLAAANSCFNPFLYYFAGENFKARLRAIFSKDHL |
Gene Information
Entrez Gene ID
Gene Name
cysteinyl leukotriene receptor 2
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
GO:0001631 | IEA:Ensembl | F | cysteinyl leukotriene receptor activity |
GO:0070374 | IMP:RGD | P | positive regulation of ERK1 and ERK2 cascade |
GO:0045766 | IMP:RGD | P | positive regulation of angiogenesis |
GO:0010942 | IMP:RGD | P | positive regulation of cell death |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko04020 | Calcium signaling pathway |
rno04020 | Calcium signaling pathway |
ko04080 | Neuroactive ligand-receptor interaction |
rno04080 | Neuroactive ligand-receptor interaction |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5954122 | Class A/1 (Rhodopsin-like receptors) |
5954202 | Eicosanoid ligand-binding receptors |
5953653 | G alpha (q) signalling events |
5953642 | GPCR downstream signaling |
5953758 | GPCR ligand binding |
5953537 | Gastrin-CREB signalling pathway via PKC and MAPK |
5954203 | Leukotriene receptors |
5953381 | Signal Transduction |
5953391 | Signaling by GPCR |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Receptor for cysteinyl leukotrienes. The response is mediated via a G-protein that activates a phosphatidylinositol- calcium second messenger system (By similarity) |
Similarity | Belongs to the G-protein coupled receptor 1 family |
Subcellular Location | Cell membrane; Multi-pass membrane protein. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012930 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
19173778 | RefSeq | NP_596904 | 309 | cysteinyl leukotriene receptor 2 |
Identical Sequences to LMP012930 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:19173778 | GenBank | ABT05399.1 | 309 | Sequence 22 from patent US 7217800 |
GI:19173778 | RefSeq | XP_008769064.1 | 309 | PREDICTED: cysteinyl leukotriene receptor 2 isoform X2 [Rattus norvegicus] |
GI:19173778 | RefSeq | XP_008769065.1 | 309 | PREDICTED: cysteinyl leukotriene receptor 2 isoform X2 [Rattus norvegicus] |
GI:19173778 | RefSeq | XP_008769066.1 | 309 | PREDICTED: cysteinyl leukotriene receptor 2 isoform X2 [Rattus norvegicus] |
Related Sequences to LMP012930 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:19173778 | EMBL | CAJ58196.1 | 309 | unnamed protein product [Rattus norvegicus] |
GI:19173778 | RefSeq | XP_008769064.1 | 309 | PREDICTED: cysteinyl leukotriene receptor 2 isoform X2 [Rattus norvegicus] |
GI:19173778 | RefSeq | XP_008769065.1 | 309 | PREDICTED: cysteinyl leukotriene receptor 2 isoform X2 [Rattus norvegicus] |
GI:19173778 | SwissProt | Q924T9.1 | 309 | RecName: Full=Cysteinyl leukotriene receptor 2; Short=CysLTR2; AltName: Full=RSBPT32 [Rattus norvegicus] |