Gene/Proteome Database (LMPD)

LMPD ID
LMP012931
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4
Gene Symbol
Alternate Names
beta-1,3-galactosyltransferase 4; GAL-T2; b3Gal-T4; beta3GalT4; beta3Gal-T4; beta-1,3-GalTase 4; ganglioside galactosyltransferase; UDP-galactose:beta-N-acetyl-galactosamine-beta-1,3-galactosyltransferase;
Chromosome
20
Map Location
20p12
Summary
catalyzes the synthesis of gangliosides GD1b, GM1, and asialo-GM1 (GA1); may mediate the formation and differentiation of brain tissues [RGD, Feb 2006]
Orthologs

Proteins

beta-1,3-galactosyltransferase 4
Refseq ID NP_598237
Protein GI 257900470
UniProt ID Q6MGC2
mRNA ID NM_133553
Length 371
MPLSLFRRLLLAVLLLVIIWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPNPQACGGSGPPPFLLILVCTAPEHLNQRNAIRGSWGAIREARGFRVQTLFLLGEPMGQQFADLASESAAQGDVLQASFQDSYRNLTLKTLTGLNWVNKYCPMARYILKTDDDVYVNVPELVSELIQRGGPSEQWQKGKEPQEETTAVHKEHKGQAVPLLYLGRVHWRVRPTRTPESRHHVSEELWPENWGPFPPYASGTGYVLSISAVQLILKVASRAPYLPLEDVFVGVSARRGGLAPTHCVKLAGATHYPLDRCCYGKFLLTSHKVDPWKMQEAWKLVRGLNGRRTEPFCSWLQGFLGTLRCRFIAWLNS

Gene Information

Entrez Gene ID
Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008378 IEA:InterPro F galactosyltransferase activity
GO:0006486 IEA:InterPro P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
ko00604 Glycosphingolipid biosynthesis - ganglio series
rno00604 Glycosphingolipid biosynthesis - ganglio series
rno01100 Metabolic pathways
ko00514 Other types of O-glycan biosynthesis
rno00514 Other types of O-glycan biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002659 Glycosyl transferase, family 31

UniProt Annotations

Entry Information

Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4
Protein Entry
Q6MGC2_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP012931 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
257900470 RefSeq NP_598237 371 beta-1,3-galactosyltransferase 4

Identical Sequences to LMP012931 proteins

Reference Database Accession Length Protein Name
GI:257900470 EMBL CAE83924.1 371 UDP-Gal:betaGlcNAc beta 1, 3-galactosyltransferase, polypeptide 4 [Rattus norvegicus]
GI:257900470 GenBank AAI26084.1 371 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 [Rattus norvegicus]
GI:257900470 GenBank EDL96844.1 371 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 [Rattus norvegicus]

Related Sequences to LMP012931 proteins

Reference Database Accession Length Protein Name
GI:257900470 EMBL CAE83924.1 371 UDP-Gal:betaGlcNAc beta 1, 3-galactosyltransferase, polypeptide 4 [Rattus norvegicus]
GI:257900470 GenBank AAI26084.1 371 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 [Rattus norvegicus]
GI:257900470 GenBank EDL96844.1 371 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 [Rattus norvegicus]
GI:257900470 SwissProt O88178.1 371 RecName: Full=Beta-1,3-galactosyltransferase 4; Short=Beta-1,3-GalTase 4; Short=Beta3Gal-T4; Short=Beta3GalT4; Short=b3Gal-T4; AltName: Full=Gal-T2; AltName: Full=Ganglioside galactosyltransferase; AltName: Full=UDP-galactose:beta-N-acetyl-galactosamine-beta-1,3-galactosyltransferase [Rattus norvegicus]