Gene/Proteome Database (LMPD)

LMPD ID
LMP012932
Gene ID
171082
Species
Rattus norvegicus (Rat)
Gene Name
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
Gene Symbol
Atp5g2
Alternate Names
ATP synthase F(0) complex subunit C2, mitochondrial; ATPase protein 9; ATPase subunit c; ATP synthase proteolipid P2; ATP synthase lipid-binding protein, mitochondrial; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9); ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2;
Chromosome
7
Map Location
7q36
Summary
component of mitochondrial ATPase; displays increased expression in pancreas after alcohol consumption [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Atp5g2

Proteins

ATP synthase F(0) complex subunit C2, mitochondrial precursor
Refseq ID NP_598240
Protein GI 19424234
UniProt ID Q06646
mRNA ID NM_133556
Length 141
MYACSKFVSTRSLIRSTSQLLSRPLSAVELKRPQMPTDEGLSCLAVRRPLTSLIPSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
transit_peptide: 1..66 experiment: experimental evidence, no additional details recorded note: Mitochondrion; propagated from UniProtKB/Swiss-Prot (Q06646.1) calculated_mol_wt: 7328 peptide sequence: MYACSKFVSTRSLIRSTSQLLSRPLSAVELKRPQMPTDEGLSCLAVRRPLTSLIPSRSFQTSAISR mat_peptide: 67..141 product: ATP synthase F(0) complex subunit C2, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q06646.1) calculated_mol_wt: 7608 peptide sequence: DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

Gene Information

Entrez Gene ID
171082
Gene Name
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
Gene Symbol
Atp5g2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0045263 IEA:UniProtKB-KW C proton-transporting ATP synthase complex, coupling factor F(o)
GO:0015078 IEA:InterPro F hydrogen ion transmembrane transporter activity
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0015991 IEA:InterPro P ATP hydrolysis coupled proton transport
GO:0015986 IEA:InterPro P ATP synthesis coupled proton transport
GO:0045471 IEP:RGD P response to ethanol

KEGG Pathway Links

KEGG Pathway ID Description
ko05010 Alzheimer's disease
rno05010 Alzheimer's disease
M00158 F-type ATPase, eukaryotes
ko05016 Huntington's disease
rno05016 Huntington's disease
rno01100 Metabolic pathways
ko00190 Oxidative phosphorylation
rno00190 Oxidative phosphorylation
rno05012 Parkinson's disease

REACTOME Pathway Links

REACTOME Pathway ID Description
5953764 Formation of ATP by chemiosmotic coupling
5953250 Metabolism
5953748 Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.
5953270 The citric acid (TCA) cycle and respiratory electron transport

Domain Information

InterPro Annotations

Accession Description
IPR000454 ATPase, F0 complex, subunit C
IPR020537 ATPase, F0 complex, subunit C, DCCD-binding site
IPR002379 V-ATPase proteolipid subunit C-like domain

UniProt Annotations

Entry Information

Gene Name
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
Protein Entry
AT5G2_RAT
UniProt ID
Q06646
Species
Rat

Comments

Comment Type Description
Disease Note=This protein is the major protein stored in the storage bodies of animals or humans affected with ceroid lipofuscinosis (Batten disease).
Function Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element.
Miscellaneous There are three genes which encode the mitochondrial ATP synthase proteolipid and they specify precursors with different import sequences. They are expressed in a tissue- specific manner.
Similarity Belongs to the ATPase C chain family
Subcellular Location Mitochondrion membrane; Multi-pass membrane protein.
Subunit F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c.

Identical and Related Proteins

Unique RefSeq proteins for LMP012932 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
19424234 RefSeq NP_598240 141 ATP synthase F(0) complex subunit C2, mitochondrial precursor

Identical Sequences to LMP012932 proteins

Reference Database Accession Length Protein Name
GI:19424234 GenBank AAI28727.1 141 ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) [Rattus norvegicus]
GI:19424234 GenBank EDL86816.1 141 rCG50567, isoform CRA_a [Rattus norvegicus]
GI:19424234 GenBank EDL86817.1 141 rCG50567, isoform CRA_a [Rattus norvegicus]
GI:19424234 SwissProt Q06646.1 141 RecName: Full=ATP synthase F(0) complex subunit C2, mitochondrial; AltName: Full=ATP synthase lipid-binding protein; AltName: Full=ATP synthase proteolipid P2; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP012932 proteins

Reference Database Accession Length Protein Name
GI:19424234 GenBank AAI28727.1 141 ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) [Rattus norvegicus]
GI:19424234 GenBank EDL86816.1 141 rCG50567, isoform CRA_a [Rattus norvegicus]
GI:19424234 GenBank EDL86817.1 141 rCG50567, isoform CRA_a [Rattus norvegicus]
GI:19424234 SwissProt Q06646.1 141 RecName: Full=ATP synthase F(0) complex subunit C2, mitochondrial; AltName: Full=ATP synthase lipid-binding protein; AltName: Full=ATP synthase proteolipid P2; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor [Rattus norvegicus]