Gene/Proteome Database (LMPD)

LMPD ID
LMP012935
Gene ID
171104
Species
Rattus norvegicus (Rat)
Gene Name
G protein-coupled estrogen receptor 1
Gene Symbol
Gper1
Synonyms
Gper; GPR41; Gpr30;
Alternate Names
G-protein coupled estrogen receptor 1; mER; chemokine receptor-like 2; membrane estrogen receptor; G protein-coupled receptor 30; G-protein coupled receptor 30; G-protein coupled receptor 41; chemoattractant receptor-like 2;
Chromosome
12
Map Location
12q11
Summary
an orphan G protein-coupled receptor found in lung [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Gper1

Proteins

G-protein coupled estrogen receptor 1
Refseq ID NP_598257
Protein GI 19424262
UniProt ID O08878
mRNA ID NM_133573
Length 375
MAATTPAQDVGVEIYLGPVWPAPSNSTPLALNLSLALREDAPGNLTGDLSEHQQYVIALFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAAADLILVADSLIEVFNLDEQYYDIAVLCTFMSLFLQINMYSSVFFLTWMSFDRYLALAKAMRCGLFRTKHHARLSCGLIWMASVSATLVPFTAVHLRHTEEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRALIRAHRHRGLRPRRQKALRMIFAVVLVFFICWLPENVFISVHLLQWAQPGDTPCKQSFRHAYPLTGHIVNLAAFSNSCLSPLIYSFLGETFRDKLRLYVAQKTSLPALNRFCHATLKAVIPDSTEQSDVKFSSAV

Gene Information

Entrez Gene ID
171104
Gene Name
G protein-coupled estrogen receptor 1
Gene Symbol
Gper1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IDA:UniProtKB C Golgi apparatus
GO:0030424 IDA:UniProtKB C axon
GO:0043679 IDA:UniProtKB C axon terminus
GO:0030054 IEA:UniProtKB-KW C cell junction
GO:0005737 IDA:UniProtKB C cytoplasm
GO:0030659 ISS:UniProtKB C cytoplasmic vesicle membrane
GO:0030425 IDA:UniProtKB C dendrite
GO:0043198 IDA:UniProtKB C dendritic shaft
GO:0044327 IDA:UniProtKB C dendritic spine head
GO:0032591 IDA:UniProtKB C dendritic spine membrane
GO:0005769 ISS:UniProtKB C early endosome
GO:0005783 ISS:UniProtKB C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005622 ISS:UniProtKB C intracellular
GO:0045095 ISS:UniProtKB C keratin filament
GO:0031966 IDA:UniProtKB C mitochondrial membrane
GO:0097481 IDA:UniProtKB C neuronal postsynaptic density
GO:0005635 ISS:UniProtKB C nuclear envelope
GO:0005634 ISS:UniProtKB C nucleus
GO:0048471 ISS:UniProtKB C perinuclear region of cytoplasm
GO:0005886 IDA:UniProtKB C plasma membrane
GO:0014069 IDA:UniProtKB C postsynaptic density
GO:0045211 IEA:UniProtKB-KW C postsynaptic membrane
GO:0048786 IDA:UniProtKB C presynaptic active zone
GO:0042734 IDA:UniProtKB C presynaptic membrane
GO:0055037 ISS:UniProtKB C recycling endosome
GO:0005802 ISS:UniProtKB C trans-Golgi network
GO:0004930 IEA:UniProtKB-KW F G-protein coupled receptor activity
GO:0008144 IDA:RGD F drug binding
GO:0030284 IDA:UniProtKB F estrogen receptor activity
GO:0042562 IDA:RGD F hormone binding
GO:0017082 IDA:UniProtKB F mineralocorticoid receptor activity
GO:0005496 IDA:RGD F steroid binding
GO:0003707 IDA:RGD F steroid hormone receptor activity
GO:0030263 IDA:UniProtKB P apoptotic chromosome condensation
GO:0007049 IEA:UniProtKB-KW P cell cycle
GO:0071392 IDA:UniProtKB P cellular response to estradiol stimulus
GO:0071333 ISS:UniProtKB P cellular response to glucose stimulus
GO:0071389 IDA:UniProtKB P cellular response to mineralocorticoid stimulus
GO:0071375 ISS:UniProtKB P cellular response to peptide hormone stimulus
GO:0071356 ISS:UniProtKB P cellular response to tumor necrosis factor
GO:0051480 ISS:UniProtKB P cytosolic calcium ion homeostasis
GO:0006954 IEA:UniProtKB-KW P inflammatory response
GO:0045087 IEA:UniProtKB-KW P innate immune response
GO:0030518 IDA:RGD P intracellular steroid hormone receptor signaling pathway
GO:0031959 IDA:GOC P mineralocorticoid receptor signaling pathway
GO:0051053 IDA:UniProtKB P negative regulation of DNA metabolic process
GO:0071157 ISS:UniProtKB P negative regulation of cell cycle arrest
GO:0008285 IDA:UniProtKB P negative regulation of cell proliferation
GO:0045599 ISS:UniProtKB P negative regulation of fat cell differentiation
GO:0010629 IDA:UniProtKB P negative regulation of gene expression
GO:0050728 ISS:UniProtKB P negative regulation of inflammatory response
GO:0002695 ISS:UniProtKB P negative regulation of leukocyte activation
GO:0051055 ISS:UniProtKB P negative regulation of lipid biosynthetic process
GO:0019228 ISS:UniProtKB P neuronal action potential
GO:0030264 IDA:UniProtKB P nuclear fragmentation involved in apoptotic nuclear change
GO:0070374 IDA:UniProtKB P positive regulation of ERK1 and ERK2 cascade
GO:0045745 ISS:UniProtKB P positive regulation of G-protein coupled receptor protein signaling pathway
GO:0043410 ISS:UniProtKB P positive regulation of MAPK cascade
GO:0010579 ISS:UniProtKB P positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway
GO:0043065 IDA:UniProtKB P positive regulation of apoptotic process
GO:0030819 ISS:UniProtKB P positive regulation of cAMP biosynthetic process
GO:0030335 ISS:UniProtKB P positive regulation of cell migration
GO:0008284 ISS:UniProtKB P positive regulation of cell proliferation
GO:0043280 IDA:UniProtKB P positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0007204 ISS:UniProtKB P positive regulation of cytosolic calcium ion concentration
GO:2000353 IDA:UniProtKB P positive regulation of endothelial cell apoptotic process
GO:0045742 IMP:RGD P positive regulation of epidermal growth factor receptor signaling pathway
GO:0090004 ISS:UniProtKB P positive regulation of establishment of protein localization to plasma membrane
GO:2001238 IDA:UniProtKB P positive regulation of extrinsic apoptotic signaling pathway
GO:0010628 IDA:UniProtKB P positive regulation of gene expression
GO:0032962 ISS:UniProtKB P positive regulation of inositol trisphosphate biosynthetic process
GO:0032024 ISS:UniProtKB P positive regulation of insulin secretion
GO:0050769 ISS:UniProtKB P positive regulation of neurogenesis
GO:0001956 ISS:UniProtKB P positive regulation of neurotransmitter secretion
GO:0014068 IDA:RGD P positive regulation of phosphatidylinositol 3-kinase signaling
GO:0001934 IDA:UniProtKB P positive regulation of protein phosphorylation
GO:0090200 IDA:UniProtKB P positive regulation of release of cytochrome c from mitochondria
GO:0051281 ISS:UniProtKB P positive regulation of release of sequestered calcium ion into cytosol
GO:0045944 ISS:UniProtKB P positive regulation of transcription from RNA polymerase II promoter
GO:0070474 ISS:UniProtKB P positive regulation of uterine smooth muscle contraction
GO:0045909 IDA:UniProtKB P positive regulation of vasodilation
GO:0043401 IDA:GOC P steroid hormone mediated signaling pathway

KEGG Pathway Links

KEGG Pathway ID Description
ko04915 Estrogen signaling pathway
rno04915 Estrogen signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5954122 Class A/1 (Rhodopsin-like receptors)
5954152 G alpha (i) signalling events
5953642 GPCR downstream signaling
5953758 GPCR ligand binding
5954121 Peptide ligand-binding receptors
5953381 Signal Transduction
5953391 Signaling by GPCR

Domain Information

InterPro Annotations

Accession Description
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM

UniProt Annotations

Entry Information

Gene Name
G protein-coupled estrogen receptor 1
Protein Entry
GPER1_RAT
UniProt ID
O08878
Species
Rat

Comments

Comment Type Description
Function G-protein coupled estrogen receptor that binds to 17- beta-estradiol (E2) with high affinity, leading to rapid and transient activation of numerous intracellular signaling pathways. Stimulates cAMP production, calcium mobilization and tyrosine kinase Src inducing the release of heparin-bound epidermal growth factor (HB-EGF) and subsequent transactivation of the epidermal growth factor receptor (EGFR), activating downstream signaling pathways such as PI3K/Akt and ERK/MAPK. Mediates pleiotropic functions among others in the cardiovascular, endocrine, reproductive, immune and central nervous systems. Has a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a RAMP3-dependent manner. Regulates arterial blood pressure by stimulating vasodilation and reducing vascular smooth muscle and microvascular endothelial cell proliferation. Plays a role in blood glucose homeostasis contributing to the insulin secretion response by pancreatic beta cells. Triggers mitochondrial apoptosis during pachytene spermatocyte differentiation. Stimulates uterine epithelial cell proliferation. Enhances uterine contractility in response to oxytocin. Contributes to thymic atrophy by inducing apoptosis. Attenuates TNF-mediated endothelial expression of leukocyte adhesion molecules. Promotes neuritogenesis in developing hippocampal neurons. Plays a role in acute neuroprotection against NMDA- induced excitotoxic neuronal death. Increases firing activity and intracellular calcium oscillations in luteinizing hormone- releasing hormone (LHRH) neurons. Inhibits early osteoblast proliferation at growth plate during skeletal development. Inhibits mature adipocyte differentiation and lipid accumulation. Involved in the recruitment of beta-arrestin 2 ARRB2 at the plasma membrane in epithelial cells. Functions also as a receptor for aldosterone mediating rapid regulation of vascular contractibility through the PI3K/ERK signaling pathway. Involved in cancer progression regulation. Stimulates cancer-associated fibroblast (CAF) proliferation by a rapid genomic response through the EGFR/ERK transduction pathway. Associated with EGFR, may act as a transcription factor activating growth regulatory genes (c-fos, cyclin D1). Promotes integrin alpha-5/beta-1 and fibronectin (FN) matrix assembly in breast cancer cells
Ptm Glycosylated
Ptm Ubiquitinated; ubiquitination occurs at the plasma membrane and leads to proteasome-mediated degradation
Similarity Belongs to the G-protein coupled receptor 1 family
Subcellular Location Nucleus . Cytoplasm, perinuclear region . Cytoplasm. Cytoplasm, cytoskeleton. Cytoplasmic vesicle membrane ; Multi- pass membrane protein . Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane ; Multi-pass membrane protein {ECO:0000250}. Early endosome . Recycling endosome . Golgi apparatus, trans-Golgi network . Golgi apparatus membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell projection, dendritic spine membrane; Multi-pass membrane protein. Cell projection, axon. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density. Mitochondrion membrane; Multi-pass membrane protein. Note=Endocytosed in a agonist- and arrestin- independent manner. Colocalized with RAMP3 and clathrin-coated pits at the plasma membrane. Colocalized with transferrin receptor at the plasma membrane and perinuclear region. Accumulated and colocalized with RAB11 proteins in recycling endosomes and trans- Golgi network (TGN), but does neither recycle back to the cell surface nor traffics to late endosome or lysosome. Colocalized with calnexin in the endoplasmic reticulum. Traffics to intracellular sites via cytokeratin intermediate filaments like KRT7 and KRT8 after constitutive endocytosis in epithelial cells. Colocalized with EGFR in the nucleus of agonist-induced cancer- associated fibroblasts (CAF) (By similarity). Colocalized with BSN to the active zone of presynaptic density. Colocalized with DLG4/PSD95 and neurabin-2 PPP1R9B in neuronal synaptosomes
Subunit Homodimer (Probable). Heterodimer; heterodimerizes with other G-protein-coupled receptor (GPCRs) like CRHR1, HTR1A and PAQR8. Interacts with RAMP3. Interacts with KRT7 and KRT8. Interacts with EGFR; the interaction increases after agonist- induced stimulation in cancer-associated fibroblasts (CAF). Interacts with EGFR and ESR1 (By similarity). Interacts (via C- terminus tail motif) with DLG4 (via N-terminus tandem pair of PDZ domains); the interaction is direct and induces the increase of GPER1 protein levels residing at the plasma membrane surface in a estradiol-independent manner. {ECO:0000250, ECO:0000269|PubMed:23300088, ECO:0000305}.
Tissue Specificity Expressed in the brain. Expressed in neurons of the hippocampus, hypothalamic paraventricular nucleus (PVN), supraoptic nucleus (SON) and the median eminence. Expressed in magnocellular neurosecretory cells (MNCs) which secrete oxytocin but not in MNCs which secrete vasopressin. Expressed in glial cells. Expressed in the nucleus ambiguous. Expressed in epithelial cells, in pachytene spermatocytes (PS) (at protein level). Expressed strongly in vascular endothelial cells and poorly in vascular smooth muscle cells (VSMC). Expressed in the brain, lung, pituitary gland, adrenal medulla, renal pelvis and ovary. Expressed in CA1 hippocampus. Expressed weakly in heart, skeletal muscle and kidney. {ECO:0000269|PubMed:17872373, ECO:0000269|PubMed:19420011, ECO:0000269|PubMed:20132863, ECO:0000269|PubMed:21242460, ECO:0000269|PubMed:21354433, ECO:0000269|PubMed:22919059, ECO:0000269|PubMed:23283935, ECO:0000269|PubMed:23300088, ECO:0000269|PubMed:9168987}.

Identical and Related Proteins

Unique RefSeq proteins for LMP012935 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
19424262 RefSeq NP_598257 375 G-protein coupled estrogen receptor 1

Identical Sequences to LMP012935 proteins

Reference Database Accession Length Protein Name
GI:19424262 GenBank AAC53208.1 375 orphan G-protein coupled receptor [Rattus norvegicus]
GI:19424262 SwissProt O08878.1 375 RecName: Full=G-protein coupled estrogen receptor 1; AltName: Full=Chemoattractant receptor-like 2; AltName: Full=G protein-coupled estrogen receptor 1; AltName: Full=G-protein coupled receptor 30; AltName: Full=G-protein coupled receptor 41; AltName: Full=Membrane estrogen receptor; Short=mER [Rattus norvegicus]

Related Sequences to LMP012935 proteins

Reference Database Accession Length Protein Name
GI:19424262 GenBank AAC53208.1 375 orphan G-protein coupled receptor [Rattus norvegicus]
GI:19424262 GenBank ADA49594.1 375 Sequence 2 from patent US 7625696
GI:19424262 GenBank AEU47646.1 375 Sequence 2 from patent US 8057990
GI:19424262 SwissProt O08878.1 375 RecName: Full=G-protein coupled estrogen receptor 1; AltName: Full=Chemoattractant receptor-like 2; AltName: Full=G protein-coupled estrogen receptor 1; AltName: Full=G-protein coupled receptor 30; AltName: Full=G-protein coupled receptor 41; AltName: Full=Membrane estrogen receptor; Short=mER [Rattus norvegicus]