Gene/Proteome Database (LMPD)
LMPD ID
LMP012943
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ELOVL fatty acid elongase 5
Gene Symbol
Synonyms
rELO1;
Alternate Names
elongation of very long chain fatty acids protein 5; ELOVL FA elongase 5; fatty acid elongase 1; 3-keto acyl-CoA synthase Elovl5; very-long-chain 3-oxoacyl-CoA synthase 5; elongation of very long chain fatty acids-like 5; elongation of long chain fatty acids family member 5; ELOVL family member 5, elongation of long chain fatty acids;
Chromosome
8
Map Location
8q31
EC Number
2.3.1.199
Summary
human homolog is involved in the elongation of long-chain polyunsaturated fatty acids [RGD, Feb 2006]
Orthologs
Proteins
| elongation of very long chain fatty acids protein 5 | |
|---|---|
| Refseq ID | NP_599209 |
| Protein GI | 19705493 |
| UniProt ID | Q920L7 |
| mRNA ID | NM_134382 |
| Length | 299 |
| MEHFDASLSTYFRALLGPRDTRVKGWFLLDNYIPTFVCSAIYLLIVWLGPKYMKNRQPFSCRGILVVYNLGLTLLSLYMFYELVTGVWEGKYNFFCQGTRSAGESDMKVIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHATMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSVPSMRPYLWWKKYITQGQLVQFVLTIIQTSCGVIWPCSFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKEHLKGHQNGSMTAVNGHTNNFASLENSVTSRKQRKD | |
Gene Information
Entrez Gene ID
Gene Name
ELOVL fatty acid elongase 5
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0009922 | IDA:UniProtKB | F | fatty acid elongase activity |
| GO:0034625 | ISS:UniProtKB | P | fatty acid elongation, monounsaturated fatty acid |
| GO:0034626 | IDA:UniProtKB | P | fatty acid elongation, polyunsaturated fatty acid |
| GO:0006636 | IEA:UniProtKB-UniPathway | P | unsaturated fatty acid biosynthetic process |
| GO:0042761 | IDA:UniProtKB | P | very long-chain fatty acid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko01040 | Biosynthesis of unsaturated fatty acids |
| rno01040 | Biosynthesis of unsaturated fatty acids |
| M00415 | Fatty acid biosynthesis, elongation, endoplasmic reticulum |
| ko00062 | Fatty acid elongation |
| rno00062 | Fatty acid elongation |
| ko01212 | Fatty acid metabolism |
| rno01212 | Fatty acid metabolism |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5953463 | Fatty Acyl-CoA Biosynthesis |
| 5953288 | Fatty acid, triacylglycerol, and ketone body metabolism |
| 5954541 | Linoleic acid (LA) metabolism |
| 5953250 | Metabolism |
| 5953289 | Metabolism of lipids and lipoproteins |
| 5953471 | Synthesis of very long-chain fatty acyl-CoAs |
| 5953464 | Triglyceride Biosynthesis |
| 5954542 | alpha-linolenic (omega3) and linoleic (omega6) acid metabolism |
| 5954543 | alpha-linolenic acid (ALA) metabolism |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002076 | ELO family |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2) |
| Function | Condensing enzyme that catalyzes the synthesis of monounsaturated and polyunsaturated very long chain fatty acids of C16-C20 |
| Pathway | Lipid metabolism; polyunsaturated fatty acid biosynthesis |
| Similarity | Belongs to the ELO family |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein . |
| Tissue Specificity | Highly expressed in lung and brain |
Identical and Related Proteins
Unique RefSeq proteins for LMP012943 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 19705493 | RefSeq | NP_599209 | 299 | elongation of very long chain fatty acids protein 5 |
Identical Sequences to LMP012943 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:19705493 | DBBJ | BAB69887.1 | 299 | fatty acid elongase 1 [Rattus norvegicus] |
| GI:19705493 | RefSeq | XP_006243479.1 | 299 | PREDICTED: elongation of very long chain fatty acids protein 5 isoform X1 [Rattus norvegicus] |
| GI:19705493 | SwissProt | Q920L7.1 | 299 | RecName: Full=Elongation of very long chain fatty acids protein 5; AltName: Full=3-keto acyl-CoA synthase Elovl5; AltName: Full=ELOVL fatty acid elongase 5; Short=ELOVL FA elongase 5; AltName: Full=Fatty acid elongase 1; Short=rELO1; AltName: Full=Very-long-chain 3-oxoacyl-CoA synthase 5 [Rattus norvegicus] |
Related Sequences to LMP012943 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:19705493 | DBBJ | BAB69887.1 | 299 | fatty acid elongase 1 [Rattus norvegicus] |
| GI:19705493 | GenBank | ADP36858.1 | 299 | elongation of long chain fatty acids family member 5 [Rattus norvegicus] |
| GI:19705493 | RefSeq | XP_006243479.1 | 299 | PREDICTED: elongation of very long chain fatty acids protein 5 isoform X1 [Rattus norvegicus] |
| GI:19705493 | SwissProt | Q920L7.1 | 299 | RecName: Full=Elongation of very long chain fatty acids protein 5; AltName: Full=3-keto acyl-CoA synthase Elovl5; AltName: Full=ELOVL fatty acid elongase 5; Short=ELOVL FA elongase 5; AltName: Full=Fatty acid elongase 1; Short=rELO1; AltName: Full=Very-long-chain 3-oxoacyl-CoA synthase 5 [Rattus norvegicus] |