Gene/Proteome Database (LMPD)

LMPD ID
LMP012947
Gene ID
171445
Species
Rattus norvegicus (Rat)
Gene Name
aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
Gene Symbol
Akr7a2
Synonyms
Aiar;
Alternate Names
aflatoxin B1 aldehyde reductase member 2; rAFAR2; SSA reductase; succinic semialdehyde reductase;
Chromosome
5
Map Location
5q36
EC Number
1.1.1.n11

Proteins

aflatoxin B1 aldehyde reductase member 2
Refseq ID NP_599234
Protein GI 19705537
UniProt ID Q8CG45
mRNA ID NM_134407
Length 338
MSRSPAPRAVSGAPLRPGTVLGTMEMGRRMDASASAATVRAFLERGLNELDTAFMYCDGQSESILGSLGLGLGSGDCTVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPRVDLFYLHAPDHGTPIVETLQACQQLHQEGKFVELGLSNYASWEVAEIYTLCKSNGWILPTVYQGMYNATTRQVETELLPCLRYFGLRFYAYNPLAGGLLTGKYRYEDKDGKQPEGRFFGNSWSETYRNRFWKEHHFEAIALVEKALKTTYGTSAPSMTSAALRWMYHHSQLQGTRGDAVILGMSSLEQLEQNLAATEEGPLEPAVVEAFNQAWNVVAHECPNYFR

Gene Information

Entrez Gene ID
171445
Gene Name
aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
Gene Symbol
Akr7a2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IDA:RGD C Golgi apparatus
GO:0005739 IEA:Ensembl C mitochondrion
GO:0004032 IDA:RGD F alditol:NADP+ 1-oxidoreductase activity
GO:0004033 NAS:RGD F aldo-keto reductase (NADP) activity

KEGG Pathway Links

KEGG Pathway ID Description
ko00980 Metabolism of xenobiotics by cytochrome P450
rno00980 Metabolism of xenobiotics by cytochrome P450

REACTOME Pathway Links

REACTOME Pathway ID Description
5953686 Aflatoxin activation and detoxification
5953258 Biological oxidations
5953250 Metabolism

Domain Information

InterPro Annotations

Accession Description
IPR001395 Aldo/keto reductase
IPR023210 NADP-dependent oxidoreductase domain

UniProt Annotations

Entry Information

Gene Name
aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
Protein Entry
ARK72_RAT
UniProt ID
Q8CG45
Species
Rat

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: Note=Has a low KM for succinic semialdehyde.;
Catalytic Activity 4-hydroxybutanoate + NADP(+) = succinate semialdehyde + NADPH.
Function Catalyzes the NADPH-dependent reduction of succinic semialdehyde to gamma-hydroxybutyrate. May have an important role in producing the neuromodulator gamma-hydroxybutyrate (GHB). Has broad substrate specificity. Can reduce the dialdehyde protein- binding form of aflatoxin B1 (AFB1) to the non-binding AFB1 dialcohol. Acts as a 2-carboxybenzaldehyde reductase
Miscellaneous With 4-nitrobenzaldehyde as substrate, it exhibits a substantially greater specic activity with NADPH than with NADH. Conversely, it has a 1.8-fold higher activity towards succinic semialdehyde with NADH than with NADPH.
Sequence Caution Sequence=AAH61816.1; Type=Erroneous initiation; Evidence= ; Sequence=BAA90396.1; Type=Erroneous initiation; Evidence= ; Sequence=CAC81080.1; Type=Erroneous initiation; Evidence= ;
Similarity Belongs to the aldo/keto reductase family. Aldo/keto reductase 2 subfamily
Subcellular Location Golgi apparatus, Golgi stack . Cytoplasm . Note=Its association with the Golgi stack may facilitate secretion of GHB.
Subunit Homodimer. Heterodimer with AKR7A1

Identical and Related Proteins

Unique RefSeq proteins for LMP012947 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
19705537 RefSeq NP_599234 338 aflatoxin B1 aldehyde reductase member 2

Identical Sequences to LMP012947 proteins

Reference Database Accession Length Protein Name
GI:19705537 DBBJ BAA90396.1 338 androgen-inducible aldehyde reductase [Rattus norvegicus]
GI:19705537 GenBank AAH61816.1 338 Aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase) [Rattus norvegicus]

Related Sequences to LMP012947 proteins

Reference Database Accession Length Protein Name
GI:19705537 DBBJ BAA90396.1 338 androgen-inducible aldehyde reductase [Rattus norvegicus]
GI:19705537 GenBank AAH61816.1 338 Aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase) [Rattus norvegicus]
GI:19705537 GenBank EDL80915.1 367 aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase), isoform CRA_b [Rattus norvegicus]
GI:19705537 SwissProt Q8CG45.2 367 RecName: Full=Aflatoxin B1 aldehyde reductase member 2; Short=rAFAR2; AltName: Full=Succinic semialdehyde reductase; Short=SSA reductase [Rattus norvegicus]