Gene/Proteome Database (LMPD)
LMPD ID
LMP012952
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
aldo-keto reductase family 1, member C14
Gene Symbol
Synonyms
Akr1c9;
Alternate Names
3-alpha-hydroxysteroid dehydrogenase; 3-alpha-HSD; steroid 3-alpha-dehydrogenase; hydroxyprostaglandin dehydrogenase;
Chromosome
17
Map Location
17q12.3
EC Number
1.1.1.50
Summary
catalyzes the conversion of 5 alpha-dihydrotestosterone to 3 alpha-androstanediol in steroid metabolism [RGD, Feb 2006]
Orthologs
Proteins
3-alpha-hydroxysteroid dehydrogenase | |
---|---|
Refseq ID | NP_612556 |
Protein GI | 19924087 |
UniProt ID | P23457 |
mRNA ID | NM_138547 |
Length | 322 |
MDSISLRVALNDGNFIPVLGFGTTVPEKVAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTVKREDIFYTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALQPGDIFFPRDEHGKLLFETVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSSRDKTWVDQKSPVLLDDPVLCAIAKKYKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNAKYFDDHPNHPFTDE |
Gene Information
Entrez Gene ID
Gene Name
aldo-keto reductase family 1, member C14
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
GO:0047042 | IEA:UniProtKB-EC | F | androsterone dehydrogenase (B-specific) activity |
GO:0016229 | IMP:RGD | F | steroid dehydrogenase activity |
GO:0021766 | IEP:RGD | P | hippocampus development |
GO:0008202 | TAS:RGD | P | steroid metabolic process |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY-6370 | ascorbate recycling (cytosolic) |
PWY-6061 | bile acid biosynthesis, neutral pathway |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5953493 | Arachidonic acid metabolism |
5953720 | Bile acid and bile salt metabolism |
5953253 | Disease |
5953382 | Diseases associated with visual transduction |
5953250 | Metabolism |
5953289 | Metabolism of lipids and lipoproteins |
5954392 | Retinoid metabolism and transport |
5953381 | Signal Transduction |
5953930 | Synthesis of bile acids and bile salts |
5953933 | Synthesis of bile acids and bile salts via 24-hydroxycholesterol |
5953929 | Synthesis of bile acids and bile salts via 27-hydroxycholesterol |
5953931 | Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol |
5953492 | Synthesis of Prostaglandins (PG) and Thromboxanes (TX) |
5953380 | Visual phototransduction |
Domain Information
UniProt Annotations
Entry Information
Gene Name
aldo-keto reductase family 1, member C14
Protein Entry
DIDH_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Catalytic Activity | A 3-alpha-hydroxysteroid + NAD(P)(+) = a 3- oxosteroid + NAD(P)H. |
Enzyme Regulation | Potently inhibited by the nonsteroidal anti- inflammatory drugs (NSAID). |
Function | Besides being a 3-alpha-hydroxysteroid dehydrogenase, the enzyme can accomplish diverse functions: as quinone reductase, as an aromatic alcohol dehydrogenase, as dihydrodiol dehydrogenase, and as 9-, 11-, and 15-hydroxyprostaglandin dehydrogenase. |
Similarity | Belongs to the aldo/keto reductase family |
Subcellular Location | Cytoplasm. |
Subunit | Monomer |
Tissue Specificity | In brain, highest levels found in olfactory bulb. Moderate levels present in cerebellum, cerebral cortex, hypothalamus and pituitary. Low levels present in amygdala, brain stem, caudate putamen, cingulate cortex, hippocampus, midbrain, and thalamus |
Identical and Related Proteins
Unique RefSeq proteins for LMP012952 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
19924087 | RefSeq | NP_612556 | 322 | 3-alpha-hydroxysteroid dehydrogenase |
Identical Sequences to LMP012952 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:19924087 | EMBL | CDM21972.1 | 322 | unnamed protein product [Rattus norvegicus] |
GI:19924087 | EMBL | CDM43050.1 | 322 | unnamed protein product [Rattus norvegicus] |
GI:19924087 | EMBL | CDM55235.1 | 322 | unnamed protein product [Rattus norvegicus] |
GI:19924087 | GenBank | ACQ18781.1 | 322 | Sequence 36 from patent US 7510851 |
Related Sequences to LMP012952 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:19924087 | DBBJ | BAA04132.1 | 322 | steroid 3-alpha-dehydrogenase [Rattus norvegicus] |
GI:19924087 | GenBank | AAA40605.1 | 322 | 3-alpha-hydroxysteroid dehydrogenase [Rattus norvegicus] |
GI:19924087 | GenBank | AAA41077.1 | 322 | dihydrodiol dehydrogenase [Rattus norvegicus] |
GI:19924087 | SwissProt | P23457.1 | 322 | RecName: Full=3-alpha-hydroxysteroid dehydrogenase; Short=3-alpha-HSD; AltName: Full=Hydroxyprostaglandin dehydrogenase [Rattus norvegicus] |