Gene/Proteome Database (LMPD)

LMPD ID
LMP012952
Gene ID
191574
Species
Rattus norvegicus (Rat)
Gene Name
aldo-keto reductase family 1, member C14
Gene Symbol
Akr1c14
Synonyms
Akr1c9;
Alternate Names
3-alpha-hydroxysteroid dehydrogenase; 3-alpha-HSD; steroid 3-alpha-dehydrogenase; hydroxyprostaglandin dehydrogenase;
Chromosome
17
Map Location
17q12.3
EC Number
1.1.1.50
Summary
catalyzes the conversion of 5 alpha-dihydrotestosterone to 3 alpha-androstanediol in steroid metabolism [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Akr1c14

Proteins

3-alpha-hydroxysteroid dehydrogenase
Refseq ID NP_612556
Protein GI 19924087
UniProt ID P23457
mRNA ID NM_138547
Length 322
MDSISLRVALNDGNFIPVLGFGTTVPEKVAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTVKREDIFYTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALQPGDIFFPRDEHGKLLFETVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSSRDKTWVDQKSPVLLDDPVLCAIAKKYKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNAKYFDDHPNHPFTDE

Gene Information

Entrez Gene ID
191574
Gene Name
aldo-keto reductase family 1, member C14
Gene Symbol
Akr1c14
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0047042 IEA:UniProtKB-EC F androsterone dehydrogenase (B-specific) activity
GO:0016229 IMP:RGD F steroid dehydrogenase activity
GO:0021766 IEP:RGD P hippocampus development
GO:0008202 TAS:RGD P steroid metabolic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-6370 ascorbate recycling (cytosolic)
PWY-6061 bile acid biosynthesis, neutral pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5953493 Arachidonic acid metabolism
5953720 Bile acid and bile salt metabolism
5953253 Disease
5953382 Diseases associated with visual transduction
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5954392 Retinoid metabolism and transport
5953381 Signal Transduction
5953492 Synthesis of Prostaglandins (PG) and Thromboxanes (TX)
5953930 Synthesis of bile acids and bile salts
5953933 Synthesis of bile acids and bile salts via 24-hydroxycholesterol
5953929 Synthesis of bile acids and bile salts via 27-hydroxycholesterol
5953931 Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol
5953380 Visual phototransduction

Domain Information

InterPro Annotations

Accession Description
IPR001395 Aldo/keto reductase
IPR020471 Aldo/keto reductase subgroup
IPR018170 Aldo/keto reductase, conserved site
IPR023210 NADP-dependent oxidoreductase domain

UniProt Annotations

Entry Information

Gene Name
aldo-keto reductase family 1, member C14
Protein Entry
DIDH_RAT
UniProt ID
P23457
Species
Rat

Comments

Comment Type Description
Catalytic Activity A 3-alpha-hydroxysteroid + NAD(P)(+) = a 3- oxosteroid + NAD(P)H.
Enzyme Regulation Potently inhibited by the nonsteroidal anti- inflammatory drugs (NSAID).
Function Besides being a 3-alpha-hydroxysteroid dehydrogenase, the enzyme can accomplish diverse functions: as quinone reductase, as an aromatic alcohol dehydrogenase, as dihydrodiol dehydrogenase, and as 9-, 11-, and 15-hydroxyprostaglandin dehydrogenase.
Similarity Belongs to the aldo/keto reductase family
Subcellular Location Cytoplasm.
Subunit Monomer
Tissue Specificity In brain, highest levels found in olfactory bulb. Moderate levels present in cerebellum, cerebral cortex, hypothalamus and pituitary. Low levels present in amygdala, brain stem, caudate putamen, cingulate cortex, hippocampus, midbrain, and thalamus

Identical and Related Proteins

Unique RefSeq proteins for LMP012952 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
19924087 RefSeq NP_612556 322 3-alpha-hydroxysteroid dehydrogenase

Identical Sequences to LMP012952 proteins

Reference Database Accession Length Protein Name
GI:19924087 EMBL CDM21972.1 322 unnamed protein product [Rattus norvegicus]
GI:19924087 EMBL CDM43050.1 322 unnamed protein product [Rattus norvegicus]
GI:19924087 EMBL CDM55235.1 322 unnamed protein product [Rattus norvegicus]
GI:19924087 GenBank ACQ18781.1 322 Sequence 36 from patent US 7510851

Related Sequences to LMP012952 proteins

Reference Database Accession Length Protein Name
GI:19924087 DBBJ BAA04132.1 322 steroid 3-alpha-dehydrogenase [Rattus norvegicus]
GI:19924087 GenBank AAA40605.1 322 3-alpha-hydroxysteroid dehydrogenase [Rattus norvegicus]
GI:19924087 GenBank AAA41077.1 322 dihydrodiol dehydrogenase [Rattus norvegicus]
GI:19924087 SwissProt P23457.1 322 RecName: Full=3-alpha-hydroxysteroid dehydrogenase; Short=3-alpha-HSD; AltName: Full=Hydroxyprostaglandin dehydrogenase [Rattus norvegicus]