Gene/Proteome Database (LMPD)

LMPD ID
LMP012965
Gene ID
192275
Species
Rattus norvegicus (Rat)
Gene Name
defender against cell death 1
Gene Symbol
Dad1
Alternate Names
dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; DAD-1; oligosaccharyl transferase subunit DAD1;
Chromosome
15
Map Location
15p13
EC Number
2.4.99.18
Summary
human homolog inhibits apoptosis [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Dad1

Proteins

dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
Refseq ID NP_620265
Protein GI 20302111
UniProt ID P61805
mRNA ID NM_138910
Length 113
MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG

Gene Information

Entrez Gene ID
192275
Gene Name
defender against cell death 1
Gene Symbol
Dad1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008250 ISS:UniProtKB C oligosaccharyltransferase complex
GO:0004579 IEA:InterPro F dolichyl-diphosphooligosaccharide-protein glycotransferase activity
GO:0006915 IEA:UniProtKB-KW P apoptotic process
GO:0001824 IEA:Ensembl P blastocyst development
GO:0043066 IEA:Ensembl P negative regulation of apoptotic process
GO:0006486 ISS:UniProtKB P protein glycosylation
GO:0042493 IEP:RGD P response to drug
GO:0007584 IEP:RGD P response to nutrient

KEGG Pathway Links

KEGG Pathway ID Description
rno01100 Metabolic pathways
ko00510 N-Glycan biosynthesis
rno00510 N-Glycan biosynthesis
M00072 N-glycosylation by oligosaccharyltransferase
ko04141 Protein processing in endoplasmic reticulum
rno04141 Protein processing in endoplasmic reticulum

Domain Information

InterPro Annotations

Accession Description
IPR003038 DAD/Ost2

UniProt Annotations

Entry Information

Gene Name
defender against cell death 1
Protein Entry
DAD1_RAT
UniProt ID
P61805
Species
Rat

Comments

Comment Type Description
Catalytic Activity Dolichyl diphosphooligosaccharide + [protein]- L-asparagine = dolichyl diphosphate + a glycoprotein with the oligosaccharide chain attached by N-beta-D-glycosyl linkage to a protein L-asparagine.
Function Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER) (By similarity). Loss of the DAD1 protein triggers apoptosis
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the DAD/OST2 family
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein .
Subunit Component of the oligosaccharyltransferase (OST) complex. OST seems to exist in different forms which contain at least RPN1, RPN2, OST48, DAD1, OSTC, KRTCAP2 and either STT3A or STT3B. OST can form stable complexes with the Sec61 complex or with both the Sec61 and TRAP complexes (By similarity)

Identical and Related Proteins

Unique RefSeq proteins for LMP012965 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
20302111 RefSeq NP_620265 113 dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1

Identical Sequences to LMP012965 proteins

Reference Database Accession Length Protein Name
GI:20302111 RefSeq XP_008588297.1 113 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 isoform X2 [Galeopterus variegatus]
GI:20302111 RefSeq XP_008708740.1 113 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Ursus maritimus]
GI:20302111 RefSeq XP_008838140.1 113 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Nannospalax galili]
GI:20302111 RefSeq XP_010376647.1 113 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Rhinopithecus roxellana]

Related Sequences to LMP012965 proteins

Reference Database Accession Length Protein Name
GI:20302111 DBBJ BAA03651.1 113 DAD-1 [Mesocricetus auratus]
GI:20302111 DBBJ BAA03650.1 113 DAD-1 [Homo sapiens]
GI:20302111 GenBank AAC53359.1 113 defender against cell death 1 protein [Mus musculus]
GI:20302111 GenBank AAB58539.1 113 defender against death 1 protein [Mus musculus]