Gene/Proteome Database (LMPD)
LMPD ID
LMP012973
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
adiponectin, C1Q and collagen domain containing
Gene Symbol
Synonyms
Acdc; Acrp30;
Alternate Names
adiponectin; adipocyte complement related protein of 30 kDa;
Chromosome
11
Map Location
11q23
Summary
adipocyte complement-related factor that plays a role in obesity-related insulin resistance [RGD, Feb 2006]
Orthologs
Proteins
| adiponectin precursor | |
|---|---|
| Refseq ID | NP_653345 |
| Protein GI | 21426809 |
| UniProt ID | Q8K3R4 |
| mRNA ID | NM_144744 |
| Length | 244 |
| MLLLQALLFLLILPSHEGITATEGPGALVPPPKETCAGWMAGIPGYPGHNGIPGRDGRDGTPGEKGEKGDAGVLGPKGDPGDAGMTGAEGPRGFPGTPGRKGEPGEAAYMYHSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSMLLHLEVGDQVWLQVYGEGDNNGLYADNVNDSTFTGFLLYHDTN | |
| sig_peptide: 1..18 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2022 peptide sequence: MLLLQALLFLLILPSHEG | |
Gene Information
Entrez Gene ID
Gene Name
adiponectin, C1Q and collagen domain containing
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0071944 | ISS:UniProtKB | C | cell periphery |
| GO:0009986 | ISS:BHF-UCL | C | cell surface |
| GO:0005581 | IEA:UniProtKB-KW | C | collagen trimer |
| GO:0005783 | ISS:UniProtKB | C | endoplasmic reticulum |
| GO:0005615 | IDA:RGD | C | extracellular space |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0048471 | ISS:UniProtKB | C | perinuclear region of cytoplasm |
| GO:0043234 | IDA:RGD | C | protein complex |
| GO:0005179 | IDA:RGD | F | hormone activity |
| GO:0005102 | ISS:UniProtKB | F | receptor binding |
| GO:0033691 | IEA:Ensembl | F | sialic acid binding |
| GO:0033211 | IDA:RGD | P | adiponectin-activated signaling pathway |
| GO:0050873 | ISS:UniProtKB | P | brown fat cell differentiation |
| GO:0071320 | IDA:RGD | P | cellular response to cAMP |
| GO:0035690 | ISS:UniProtKB | P | cellular response to drug |
| GO:0071872 | IDA:RGD | P | cellular response to epinephrine stimulus |
| GO:0032869 | ISS:UniProtKB | P | cellular response to insulin stimulus |
| GO:0007623 | IEP:RGD | P | circadian rhythm |
| GO:0070994 | ISS:UniProtKB | P | detection of oxidative stress |
| GO:0006635 | ISS:UniProtKB | P | fatty acid beta-oxidation |
| GO:0019395 | ISS:UniProtKB | P | fatty acid oxidation |
| GO:0042593 | ISS:UniProtKB | P | glucose homeostasis |
| GO:0006006 | ISS:UniProtKB | P | glucose metabolic process |
| GO:0034383 | ISS:UniProtKB | P | low-density lipoprotein particle clearance |
| GO:0051899 | IDA:RGD | P | membrane depolarization |
| GO:0060081 | IDA:RGD | P | membrane hyperpolarization |
| GO:2000279 | ISS:UniProtKB | P | negative regulation of DNA biosynthetic process |
| GO:0070373 | ISS:UniProtKB | P | negative regulation of ERK1 and ERK2 cascade |
| GO:0043124 | ISS:UniProtKB | P | negative regulation of I-kappaB kinase/NF-kappaB signaling |
| GO:0043407 | ISS:UniProtKB | P | negative regulation of MAP kinase activity |
| GO:0045776 | ISS:UniProtKB | P | negative regulation of blood pressure |
| GO:0030336 | ISS:UniProtKB | P | negative regulation of cell migration |
| GO:0045599 | ISS:UniProtKB | P | negative regulation of fat cell differentiation |
| GO:0045721 | ISS:UniProtKB | P | negative regulation of gluconeogenesis |
| GO:0030853 | ISS:UniProtKB | P | negative regulation of granulocyte differentiation |
| GO:0034115 | ISS:UniProtKB | P | negative regulation of heterotypic cell-cell adhesion |
| GO:0046888 | IDA:RGD | P | negative regulation of hormone secretion |
| GO:0050728 | ISS:UniProtKB | P | negative regulation of inflammatory response |
| GO:0090317 | ISS:UniProtKB | P | negative regulation of intracellular protein transport |
| GO:0045715 | ISS:UniProtKB | P | negative regulation of low-density lipoprotein particle receptor biosynthetic process |
| GO:0010745 | ISS:UniProtKB | P | negative regulation of macrophage derived foam cell differentiation |
| GO:0045650 | ISS:UniProtKB | P | negative regulation of macrophage differentiation |
| GO:2000590 | ISS:UniProtKB | P | negative regulation of metanephric mesenchymal cell migration |
| GO:0050765 | ISS:UniProtKB | P | negative regulation of phagocytosis |
| GO:0010642 | ISS:UniProtKB | P | negative regulation of platelet-derived growth factor receptor signaling pathway |
| GO:2000584 | ISS:UniProtKB | P | negative regulation of platelet-derived growth factor receptor-alpha signaling pathway |
| GO:0031953 | ISS:UniProtKB | P | negative regulation of protein autophosphorylation |
| GO:1900121 | ISS:UniProtKB | P | negative regulation of receptor binding |
| GO:0014912 | ISS:UniProtKB | P | negative regulation of smooth muscle cell migration |
| GO:0048662 | ISS:UniProtKB | P | negative regulation of smooth muscle cell proliferation |
| GO:0050805 | ISS:UniProtKB | P | negative regulation of synaptic transmission |
| GO:0045892 | ISS:UniProtKB | P | negative regulation of transcription, DNA-templated |
| GO:0032720 | ISS:UniProtKB | P | negative regulation of tumor necrosis factor production |
| GO:0010804 | ISS:UniProtKB | P | negative regulation of tumor necrosis factor-mediated signaling pathway |
| GO:0043123 | ISS:UniProtKB | P | positive regulation of I-kappaB kinase/NF-kappaB signaling |
| GO:0045777 | IDA:RGD | P | positive regulation of blood pressure |
| GO:2000481 | ISS:UniProtKB | P | positive regulation of cAMP-dependent protein kinase activity |
| GO:0032270 | ISS:BHF-UCL | P | positive regulation of cellular protein metabolic process |
| GO:0010875 | ISS:BHF-UCL | P | positive regulation of cholesterol efflux |
| GO:0045923 | ISS:UniProtKB | P | positive regulation of fatty acid metabolic process |
| GO:0046326 | ISS:UniProtKB | P | positive regulation of glucose import |
| GO:2000467 | IDA:UniProtKB | P | positive regulation of glycogen (starch) synthase activity |
| GO:0032757 | ISS:UniProtKB | P | positive regulation of interleukin-8 production |
| GO:2000478 | ISS:UniProtKB | P | positive regulation of metanephric glomerular visceral epithelial cell development |
| GO:0071639 | ISS:UniProtKB | P | positive regulation of monocyte chemotactic protein-1 production |
| GO:0033034 | ISS:UniProtKB | P | positive regulation of myeloid cell apoptotic process |
| GO:0050731 | IDA:RGD | P | positive regulation of peptidyl-tyrosine phosphorylation |
| GO:0010739 | ISS:UniProtKB | P | positive regulation of protein kinase A signaling |
| GO:0045860 | IDA:UniProtKB | P | positive regulation of protein kinase activity |
| GO:0001934 | ISS:UniProtKB | P | positive regulation of protein phosphorylation |
| GO:2000534 | ISS:UniProtKB | P | positive regulation of renal albumin absorption |
| GO:0009967 | ISS:UniProtKB | P | positive regulation of signal transduction |
| GO:0070208 | IEA:Ensembl | P | protein heterotrimerization |
| GO:0051260 | ISS:UniProtKB | P | protein homooligomerization |
| GO:0072659 | ISS:UniProtKB | P | protein localization to plasma membrane |
| GO:0010906 | ISS:UniProtKB | P | regulation of glucose metabolic process |
| GO:0014823 | IEP:RGD | P | response to activity |
| GO:0042493 | IEP:RGD | P | response to drug |
| GO:0045471 | IEP:RGD | P | response to ethanol |
| GO:0051384 | IEP:RGD | P | response to glucocorticoid |
| GO:0009749 | ISS:UniProtKB | P | response to glucose |
| GO:0001666 | IEP:RGD | P | response to hypoxia |
| GO:0070543 | IEP:RGD | P | response to linoleic acid |
| GO:0007584 | IEP:RGD | P | response to nutrient |
| GO:0031667 | IEP:RGD | P | response to nutrient levels |
| GO:0009744 | IEP:RGD | P | response to sucrose |
| GO:0034612 | ISS:UniProtKB | P | response to tumor necrosis factor |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko04152 | AMPK signaling pathway |
| rno04152 | AMPK signaling pathway |
| ko04920 | Adipocytokine signaling pathway |
| rno04920 | Adipocytokine signaling pathway |
| ko04932 | Non-alcoholic fatty liver disease (NAFLD) |
| rno04932 | Non-alcoholic fatty liver disease (NAFLD) |
| ko03320 | PPAR signaling pathway |
| rno03320 | PPAR signaling pathway |
| ko04930 | Type II diabetes mellitus |
| rno04930 | Type II diabetes mellitus |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
adiponectin, C1Q and collagen domain containing
Protein Entry
Q8K3R4_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP012973 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 21426809 | RefSeq | NP_653345 | 244 | adiponectin precursor |
Identical Sequences to LMP012973 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:21426809 | GenBank | ACW81841.1 | 244 | Sequence 3 from patent US 7592423 |
| GI:21426809 | GenBank | ADF22674.1 | 244 | Sequence 3 from patent US 7678886 |
| GI:21426809 | GenBank | ADL91952.1 | 244 | Sequence 3 from patent US 7709607 |
| GI:21426809 | GenBank | ADS06510.1 | 244 | Sequence 3 from patent US 7749956 |
Related Sequences to LMP012973 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:21426809 | GenBank | AAK61608.1 | 244 | 30 kDa adipocyte complement-related protein [Rattus norvegicus] |
| GI:21426809 | GenBank | EDL78080.1 | 244 | adiponectin, C1Q and collagen domain containing [Rattus norvegicus] |
| GI:21426809 | GenBank | ADL91952.1 | 244 | Sequence 3 from patent US 7709607 |
| GI:21426809 | GenBank | ADS06510.1 | 244 | Sequence 3 from patent US 7749956 |