Gene/Proteome Database (LMPD)

LMPD ID
LMP012973
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
adiponectin, C1Q and collagen domain containing
Gene Symbol
Synonyms
Acdc; Acrp30;
Alternate Names
adiponectin; adipocyte complement related protein of 30 kDa;
Chromosome
11
Map Location
11q23
Summary
adipocyte complement-related factor that plays a role in obesity-related insulin resistance [RGD, Feb 2006]
Orthologs

Proteins

adiponectin precursor
Refseq ID NP_653345
Protein GI 21426809
UniProt ID Q8K3R4
mRNA ID NM_144744
Length 244
MLLLQALLFLLILPSHEGITATEGPGALVPPPKETCAGWMAGIPGYPGHNGIPGRDGRDGTPGEKGEKGDAGVLGPKGDPGDAGMTGAEGPRGFPGTPGRKGEPGEAAYMYHSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSMLLHLEVGDQVWLQVYGEGDNNGLYADNVNDSTFTGFLLYHDTN
sig_peptide: 1..18 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2022 peptide sequence: MLLLQALLFLLILPSHEG

Gene Information

Entrez Gene ID
Gene Name
adiponectin, C1Q and collagen domain containing
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0071944 ISS:UniProtKB C cell periphery
GO:0009986 ISS:BHF-UCL C cell surface
GO:0005581 IEA:UniProtKB-KW C collagen trimer
GO:0005783 ISS:UniProtKB C endoplasmic reticulum
GO:0005615 IDA:RGD C extracellular space
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0048471 ISS:UniProtKB C perinuclear region of cytoplasm
GO:0043234 IDA:RGD C protein complex
GO:0005179 IDA:RGD F hormone activity
GO:0005102 ISS:UniProtKB F receptor binding
GO:0033691 IEA:Ensembl F sialic acid binding
GO:0033211 IDA:RGD P adiponectin-activated signaling pathway
GO:0050873 ISS:UniProtKB P brown fat cell differentiation
GO:0071320 IDA:RGD P cellular response to cAMP
GO:0035690 ISS:UniProtKB P cellular response to drug
GO:0071872 IDA:RGD P cellular response to epinephrine stimulus
GO:0032869 ISS:UniProtKB P cellular response to insulin stimulus
GO:0007623 IEP:RGD P circadian rhythm
GO:0070994 ISS:UniProtKB P detection of oxidative stress
GO:0006635 ISS:UniProtKB P fatty acid beta-oxidation
GO:0019395 ISS:UniProtKB P fatty acid oxidation
GO:0042593 ISS:UniProtKB P glucose homeostasis
GO:0006006 ISS:UniProtKB P glucose metabolic process
GO:0034383 ISS:UniProtKB P low-density lipoprotein particle clearance
GO:0051899 IDA:RGD P membrane depolarization
GO:0060081 IDA:RGD P membrane hyperpolarization
GO:2000279 ISS:UniProtKB P negative regulation of DNA biosynthetic process
GO:0070373 ISS:UniProtKB P negative regulation of ERK1 and ERK2 cascade
GO:0043124 ISS:UniProtKB P negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043407 ISS:UniProtKB P negative regulation of MAP kinase activity
GO:0045776 ISS:UniProtKB P negative regulation of blood pressure
GO:0030336 ISS:UniProtKB P negative regulation of cell migration
GO:0045599 ISS:UniProtKB P negative regulation of fat cell differentiation
GO:0045721 ISS:UniProtKB P negative regulation of gluconeogenesis
GO:0030853 ISS:UniProtKB P negative regulation of granulocyte differentiation
GO:0034115 ISS:UniProtKB P negative regulation of heterotypic cell-cell adhesion
GO:0046888 IDA:RGD P negative regulation of hormone secretion
GO:0050728 ISS:UniProtKB P negative regulation of inflammatory response
GO:0090317 ISS:UniProtKB P negative regulation of intracellular protein transport
GO:0045715 ISS:UniProtKB P negative regulation of low-density lipoprotein particle receptor biosynthetic process
GO:0010745 ISS:UniProtKB P negative regulation of macrophage derived foam cell differentiation
GO:0045650 ISS:UniProtKB P negative regulation of macrophage differentiation
GO:2000590 ISS:UniProtKB P negative regulation of metanephric mesenchymal cell migration
GO:0050765 ISS:UniProtKB P negative regulation of phagocytosis
GO:0010642 ISS:UniProtKB P negative regulation of platelet-derived growth factor receptor signaling pathway
GO:2000584 ISS:UniProtKB P negative regulation of platelet-derived growth factor receptor-alpha signaling pathway
GO:0031953 ISS:UniProtKB P negative regulation of protein autophosphorylation
GO:1900121 ISS:UniProtKB P negative regulation of receptor binding
GO:0014912 ISS:UniProtKB P negative regulation of smooth muscle cell migration
GO:0048662 ISS:UniProtKB P negative regulation of smooth muscle cell proliferation
GO:0050805 ISS:UniProtKB P negative regulation of synaptic transmission
GO:0045892 ISS:UniProtKB P negative regulation of transcription, DNA-templated
GO:0032720 ISS:UniProtKB P negative regulation of tumor necrosis factor production
GO:0010804 ISS:UniProtKB P negative regulation of tumor necrosis factor-mediated signaling pathway
GO:0043123 ISS:UniProtKB P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0045777 IDA:RGD P positive regulation of blood pressure
GO:2000481 ISS:UniProtKB P positive regulation of cAMP-dependent protein kinase activity
GO:0032270 ISS:BHF-UCL P positive regulation of cellular protein metabolic process
GO:0010875 ISS:BHF-UCL P positive regulation of cholesterol efflux
GO:0045923 ISS:UniProtKB P positive regulation of fatty acid metabolic process
GO:0046326 ISS:UniProtKB P positive regulation of glucose import
GO:2000467 IDA:UniProtKB P positive regulation of glycogen (starch) synthase activity
GO:0032757 ISS:UniProtKB P positive regulation of interleukin-8 production
GO:2000478 ISS:UniProtKB P positive regulation of metanephric glomerular visceral epithelial cell development
GO:0071639 ISS:UniProtKB P positive regulation of monocyte chemotactic protein-1 production
GO:0033034 ISS:UniProtKB P positive regulation of myeloid cell apoptotic process
GO:0050731 IDA:RGD P positive regulation of peptidyl-tyrosine phosphorylation
GO:0010739 ISS:UniProtKB P positive regulation of protein kinase A signaling
GO:0045860 IDA:UniProtKB P positive regulation of protein kinase activity
GO:0001934 ISS:UniProtKB P positive regulation of protein phosphorylation
GO:2000534 ISS:UniProtKB P positive regulation of renal albumin absorption
GO:0009967 ISS:UniProtKB P positive regulation of signal transduction
GO:0070208 IEA:Ensembl P protein heterotrimerization
GO:0051260 ISS:UniProtKB P protein homooligomerization
GO:0072659 ISS:UniProtKB P protein localization to plasma membrane
GO:0010906 ISS:UniProtKB P regulation of glucose metabolic process
GO:0014823 IEP:RGD P response to activity
GO:0042493 IEP:RGD P response to drug
GO:0045471 IEP:RGD P response to ethanol
GO:0051384 IEP:RGD P response to glucocorticoid
GO:0009749 ISS:UniProtKB P response to glucose
GO:0001666 IEP:RGD P response to hypoxia
GO:0070543 IEP:RGD P response to linoleic acid
GO:0007584 IEP:RGD P response to nutrient
GO:0031667 IEP:RGD P response to nutrient levels
GO:0009744 IEP:RGD P response to sucrose
GO:0034612 ISS:UniProtKB P response to tumor necrosis factor

KEGG Pathway Links

KEGG Pathway ID Description
ko04152 AMPK signaling pathway
rno04152 AMPK signaling pathway
ko04920 Adipocytokine signaling pathway
rno04920 Adipocytokine signaling pathway
ko04932 Non-alcoholic fatty liver disease (NAFLD)
rno04932 Non-alcoholic fatty liver disease (NAFLD)
ko03320 PPAR signaling pathway
rno03320 PPAR signaling pathway
ko04930 Type II diabetes mellitus
rno04930 Type II diabetes mellitus

REACTOME Pathway Links

REACTOME Pathway ID Description
5953533 Developmental Biology
5954166 Transcriptional regulation of white adipocyte differentiation

Domain Information

InterPro Annotations

Accession Description
IPR028572 Adiponectin
IPR008160 Collagen triple helix repeat
IPR001073 Complement C1q protein
IPR008983 Tumour necrosis factor-like domain

UniProt Annotations

Entry Information

Gene Name
adiponectin, C1Q and collagen domain containing
Protein Entry
Q8K3R4_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP012973 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
21426809 RefSeq NP_653345 244 adiponectin precursor

Identical Sequences to LMP012973 proteins

Reference Database Accession Length Protein Name
GI:21426809 GenBank ACW81841.1 244 Sequence 3 from patent US 7592423
GI:21426809 GenBank ADF22674.1 244 Sequence 3 from patent US 7678886
GI:21426809 GenBank ADL91952.1 244 Sequence 3 from patent US 7709607
GI:21426809 GenBank ADS06510.1 244 Sequence 3 from patent US 7749956

Related Sequences to LMP012973 proteins

Reference Database Accession Length Protein Name
GI:21426809 GenBank AAK61608.1 244 30 kDa adipocyte complement-related protein [Rattus norvegicus]
GI:21426809 GenBank EDL78080.1 244 adiponectin, C1Q and collagen domain containing [Rattus norvegicus]
GI:21426809 GenBank ADL91952.1 244 Sequence 3 from patent US 7709607
GI:21426809 GenBank ADS06510.1 244 Sequence 3 from patent US 7749956